Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1928418..1928598 | Replicon | chromosome |
| Accession | NZ_AP019542 | ||
| Organism | Staphylococcus aureus strain KG-03 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | GDK21_RS09450 | Protein ID | WP_001801861.1 |
| Coordinates | 1928418..1928513 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1928541..1928598 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GDK21_RS09420 | 1923581..1924231 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| GDK21_RS09425 | 1924312..1925307 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| GDK21_RS09430 | 1925382..1926008 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| GDK21_RS09435 | 1926049..1926390 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| GDK21_RS09440 | 1926491..1927063 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| GDK21_RS09445 | 1927261..1928273 | - | 1013 | Protein_1820 | IS3 family transposase | - |
| GDK21_RS09450 | 1928418..1928513 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1928541..1928598 | - | 58 | - | - | Antitoxin |
| GDK21_RS09455 | 1928636..1928737 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| GDK21_RS09460 | 1928715..1928876 | - | 162 | Protein_1823 | transposase | - |
| GDK21_RS09465 | 1928867..1929361 | - | 495 | Protein_1824 | transposase | - |
| GDK21_RS09470 | 1929813..1931042 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| GDK21_RS09475 | 1931035..1932591 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| GDK21_RS09480 | 1932755..1932889 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | tet(M) | lukD / hlgA / selk | 1890608..1973201 | 82593 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T32696 WP_001801861.1 NZ_AP019542:1928418-1928513 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T32696 NZ_AP019542:1928418-1928513 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT32696 NZ_AP019542:c1928598-1928541 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|