Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 502295..502475 | Replicon | chromosome |
Accession | NZ_AP019306 | ||
Organism | Staphylococcus aureus strain TUM9463 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | EKM74_RS02530 | Protein ID | WP_001801861.1 |
Coordinates | 502295..502390 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 502418..502475 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EKM74_RS02500 | 497590..498240 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
EKM74_RS02505 | 498321..499316 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
EKM74_RS02510 | 499391..500017 | + | 627 | WP_000669024.1 | hypothetical protein | - |
EKM74_RS02515 | 500058..500399 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
EKM74_RS02520 | 500500..501072 | + | 573 | WP_000414216.1 | hypothetical protein | - |
EKM74_RS02525 | 501270..502150 | - | 881 | Protein_486 | IS3 family transposase | - |
EKM74_RS02530 | 502295..502390 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 502418..502475 | - | 58 | - | - | Antitoxin |
EKM74_RS02535 | 502513..502614 | + | 102 | WP_001792025.1 | hypothetical protein | - |
EKM74_RS02540 | 502592..502753 | - | 162 | Protein_489 | transposase | - |
EKM74_RS02545 | 502744..503238 | - | 495 | Protein_490 | transposase | - |
EKM74_RS02550 | 503690..504919 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
EKM74_RS02555 | 504912..506468 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 496832..575367 | 78535 | |
- | flank | IS/Tn | - | - | 506678..507850 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T32590 WP_001801861.1 NZ_AP019306:502295-502390 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T32590 NZ_AP019306:502295-502390 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT32590 NZ_AP019306:c502475-502418 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|