Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 503361..503541 | Replicon | chromosome |
| Accession | NZ_AP019305 | ||
| Organism | Staphylococcus aureus strain TUM9458 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | EKM72_RS02535 | Protein ID | WP_001801861.1 |
| Coordinates | 503361..503456 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 503484..503541 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EKM72_RS02505 | 498656..499306 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| EKM72_RS02510 | 499387..500382 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| EKM72_RS02515 | 500457..501083 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| EKM72_RS02520 | 501124..501465 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| EKM72_RS02525 | 501566..502138 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| EKM72_RS02530 | 502336..503216 | - | 881 | Protein_487 | IS3 family transposase | - |
| EKM72_RS02535 | 503361..503456 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 503484..503541 | - | 58 | - | - | Antitoxin |
| EKM72_RS02540 | 503579..503680 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| EKM72_RS02545 | 503658..503819 | - | 162 | Protein_490 | transposase | - |
| EKM72_RS02550 | 503810..504304 | - | 495 | Protein_491 | transposase | - |
| EKM72_RS02555 | 504756..505985 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| EKM72_RS02560 | 505978..507534 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 497898..576433 | 78535 | |
| - | flank | IS/Tn | - | - | 507744..508916 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T32566 WP_001801861.1 NZ_AP019305:503361-503456 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T32566 NZ_AP019305:503361-503456 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT32566 NZ_AP019305:c503541-503484 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|