Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2548646..2548830 | Replicon | chromosome |
Accession | NZ_AP018923 | ||
Organism | Staphylococcus aureus strain JMUB3031 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | D5070_RS13415 | Protein ID | WP_000482647.1 |
Coordinates | 2548723..2548830 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2548646..2548706 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D5070_RS13390 | 2544120..2544287 | - | 168 | WP_001790576.1 | hypothetical protein | - |
D5070_RS13400 | 2544518..2546251 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
D5070_RS13405 | 2546276..2548039 | - | 1764 | WP_001064816.1 | ABC transporter ATP-binding protein/permease | - |
- | 2548646..2548706 | + | 61 | - | - | Antitoxin |
D5070_RS13415 | 2548723..2548830 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
D5070_RS13420 | 2548964..2549350 | - | 387 | WP_000779360.1 | flippase GtxA | - |
D5070_RS13425 | 2549608..2550750 | + | 1143 | WP_001176871.1 | glycerate kinase | - |
D5070_RS13430 | 2550810..2551469 | + | 660 | WP_000831301.1 | membrane protein | - |
D5070_RS13435 | 2551651..2552862 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
D5070_RS13440 | 2552985..2553458 | - | 474 | WP_000456497.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T32454 WP_000482647.1 NZ_AP018923:c2548830-2548723 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T32454 NZ_AP018923:c2548830-2548723 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT32454 NZ_AP018923:2548646-2548706 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|