Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprG3-sprA1AS/- |
Location | 2270142..2270339 | Replicon | chromosome |
Accession | NZ_AP018923 | ||
Organism | Staphylococcus aureus strain JMUB3031 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | D5070_RS11905 | Protein ID | WP_001802298.1 |
Coordinates | 2270235..2270339 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2270142..2270180 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D5070_RS11885 | 2266383..2267048 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
D5070_RS11890 | 2267200..2267520 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
D5070_RS11895 | 2267522..2268502 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
D5070_RS11900 | 2268768..2269859 | + | 1092 | WP_000495683.1 | hypothetical protein | - |
- | 2270142..2270180 | + | 39 | - | - | Antitoxin |
D5070_RS11905 | 2270235..2270339 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
D5070_RS11915 | 2271019..2271177 | + | 159 | WP_001792784.1 | hypothetical protein | - |
D5070_RS11925 | 2271836..2272693 | - | 858 | WP_000370917.1 | Cof-type HAD-IIB family hydrolase | - |
D5070_RS11930 | 2272761..2273543 | - | 783 | WP_000908178.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T32452 WP_001802298.1 NZ_AP018923:c2270339-2270235 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T32452 NZ_AP018923:c2270339-2270235 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT32452 NZ_AP018923:2270142-2270180 [Staphylococcus aureus]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|