Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1936200..1936382 | Replicon | chromosome |
| Accession | NZ_AP018923 | ||
| Organism | Staphylococcus aureus strain JMUB3031 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | D5070_RS09860 | Protein ID | WP_001801861.1 |
| Coordinates | 1936200..1936295 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1936323..1936382 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D5070_RS09810 | 1931870..1932496 | + | 627 | WP_000669017.1 | hypothetical protein | - |
| D5070_RS09815 | 1932537..1932878 | + | 342 | WP_000627541.1 | DUF3969 family protein | - |
| D5070_RS09820 | 1932979..1933551 | + | 573 | WP_000414202.1 | hypothetical protein | - |
| D5070_RS09825 | 1933749..1934306 | - | 558 | Protein_1848 | ImmA/IrrE family metallo-endopeptidase | - |
| D5070_RS09835 | 1934680..1934856 | - | 177 | WP_000375477.1 | hypothetical protein | - |
| D5070_RS09840 | 1934867..1935250 | - | 384 | Protein_1850 | hypothetical protein | - |
| D5070_RS09850 | 1935854..1935997 | - | 144 | WP_001549059.1 | transposase | - |
| D5070_RS09860 | 1936200..1936295 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1936323..1936382 | - | 60 | - | - | Antitoxin |
| D5070_RS09865 | 1936418..1936519 | + | 102 | WP_001791893.1 | hypothetical protein | - |
| D5070_RS09870 | 1936497..1936673 | - | 177 | Protein_1854 | transposase | - |
| D5070_RS09875 | 1936867..1937244 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA | 1929519..1990956 | 61437 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T32442 WP_001801861.1 NZ_AP018923:1936200-1936295 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T32442 NZ_AP018923:1936200-1936295 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT32442 NZ_AP018923:c1936382-1936323 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|