Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2422679..2422863 | Replicon | chromosome |
Accession | NZ_AP018922 | ||
Organism | Staphylococcus aureus strain JMUB1273 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | JMUB1273_RS12580 | Protein ID | WP_072467491.1 |
Coordinates | 2422756..2422863 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2422679..2422739 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMUB1273_RS12555 | 2418247..2418414 | - | 168 | WP_031866196.1 | hypothetical protein | - |
JMUB1273_RS12565 | 2418645..2420378 | - | 1734 | WP_119267468.1 | ABC transporter ATP-binding protein/permease | - |
JMUB1273_RS12570 | 2420403..2422166 | - | 1764 | WP_001064834.1 | ABC transporter ATP-binding protein/permease | - |
- | 2422679..2422739 | + | 61 | - | - | Antitoxin |
JMUB1273_RS12580 | 2422756..2422863 | - | 108 | WP_072467491.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
JMUB1273_RS12585 | 2422997..2423383 | - | 387 | WP_000779348.1 | flippase GtxA | - |
JMUB1273_RS12590 | 2423640..2424782 | + | 1143 | WP_001176873.1 | glycerate kinase | - |
JMUB1273_RS12595 | 2424842..2425501 | + | 660 | WP_000831298.1 | membrane protein | - |
JMUB1273_RS12600 | 2425683..2426894 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
JMUB1273_RS12605 | 2427017..2427490 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3944.67 Da Isoelectric Point: 10.4934
>T32434 WP_072467491.1 NZ_AP018922:c2422863-2422756 [Staphylococcus aureus]
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
IFNLLIDIMTSAISGCLVAFFANWLRTRSNKKGDK
Download Length: 108 bp
>T32434 NZ_AP018922:c2422863-2422756 [Staphylococcus aureus]
ATCTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCAAATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
ATCTTCAATTTATTAATTGACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCAAATTGGTTACGAAC
GCGCAGCAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT32434 NZ_AP018922:2422679-2422739 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|