Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2144575..2144791 | Replicon | chromosome |
Accession | NZ_AP018922 | ||
Organism | Staphylococcus aureus strain JMUB1273 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | JMUB1273_RS11065 | Protein ID | WP_001802298.1 |
Coordinates | 2144687..2144791 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2144575..2144630 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMUB1273_RS11045 | 2140769..2141434 | - | 666 | WP_119267464.1 | SDR family oxidoreductase | - |
JMUB1273_RS11050 | 2141586..2141906 | + | 321 | WP_000003755.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
JMUB1273_RS11055 | 2141908..2142888 | + | 981 | WP_000019743.1 | CDF family zinc efflux transporter CzrB | - |
JMUB1273_RS11060 | 2143154..2144245 | + | 1092 | WP_000495681.1 | hypothetical protein | - |
- | 2144575..2144630 | + | 56 | - | - | Antitoxin |
JMUB1273_RS11065 | 2144687..2144791 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
JMUB1273_RS11075 | 2145471..2145629 | + | 159 | WP_001792784.1 | hypothetical protein | - |
JMUB1273_RS11085 | 2146287..2147144 | - | 858 | WP_000370928.1 | Cof-type HAD-IIB family hydrolase | - |
JMUB1273_RS11090 | 2147212..2147994 | - | 783 | WP_000908189.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T32430 WP_001802298.1 NZ_AP018922:c2144791-2144687 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T32430 NZ_AP018922:c2144791-2144687 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT32430 NZ_AP018922:2144575-2144630 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|