Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 1971323..1971622 | Replicon | chromosome |
Accession | NZ_AP018922 | ||
Organism | Staphylococcus aureus strain JMUB1273 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | JMUB1273_RS10055 | Protein ID | WP_072353918.1 |
Coordinates | 1971446..1971622 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1971323..1971378 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMUB1273_RS10000 | 1966881..1967060 | + | 180 | WP_000669789.1 | hypothetical protein | - |
JMUB1273_RS10010 | 1967371..1967631 | + | 261 | WP_001791826.1 | hypothetical protein | - |
JMUB1273_RS10015 | 1967684..1968034 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
JMUB1273_RS10020 | 1968544..1968879 | - | 336 | Protein_1850 | SH3 domain-containing protein | - |
JMUB1273_RS10035 | 1969531..1970022 | - | 492 | WP_000920041.1 | staphylokinase | - |
JMUB1273_RS10040 | 1970213..1970968 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
JMUB1273_RS10045 | 1970980..1971234 | - | 255 | WP_000611512.1 | phage holin | - |
JMUB1273_RS10050 | 1971286..1971393 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1971315..1971454 | + | 140 | NuclAT_0 | - | - |
- | 1971315..1971454 | + | 140 | NuclAT_0 | - | - |
- | 1971315..1971454 | + | 140 | NuclAT_0 | - | - |
- | 1971315..1971454 | + | 140 | NuclAT_0 | - | - |
- | 1971323..1971378 | + | 56 | - | - | Antitoxin |
JMUB1273_RS10055 | 1971446..1971622 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
JMUB1273_RS10060 | 1971765..1972139 | - | 375 | WP_000340977.1 | hypothetical protein | - |
JMUB1273_RS10065 | 1972195..1972482 | - | 288 | WP_001262620.1 | hypothetical protein | - |
JMUB1273_RS10070 | 1972528..1972680 | - | 153 | WP_001000058.1 | hypothetical protein | - |
JMUB1273_RS10075 | 1972673..1976455 | - | 3783 | WP_119267461.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1967684..2020535 | 52851 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T32425 WP_072353918.1 NZ_AP018922:c1971622-1971446 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T32425 NZ_AP018922:c1971622-1971446 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT32425 NZ_AP018922:1971323-1971378 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|