Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1825031..1825211 | Replicon | chromosome |
Accession | NZ_AP018922 | ||
Organism | Staphylococcus aureus strain JMUB1273 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | JMUB1273_RS09075 | Protein ID | WP_001801861.1 |
Coordinates | 1825031..1825126 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1825154..1825211 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMUB1273_RS09035 | 1820072..1820698 | + | 627 | WP_000669019.1 | hypothetical protein | - |
JMUB1273_RS09040 | 1820739..1821080 | + | 342 | WP_000627548.1 | DUF3969 family protein | - |
JMUB1273_RS14135 | 1821181..1821753 | + | 573 | Protein_1702 | hypothetical protein | - |
JMUB1273_RS09045 | 1821951..1822508 | - | 558 | WP_000864138.1 | ImmA/IrrE family metallo-endopeptidase | - |
JMUB1273_RS09055 | 1822879..1823055 | - | 177 | WP_000375476.1 | hypothetical protein | - |
JMUB1273_RS09060 | 1823066..1823449 | - | 384 | WP_000070811.1 | hypothetical protein | - |
JMUB1273_RS09065 | 1824134..1824580 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
JMUB1273_RS09075 | 1825031..1825126 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1825154..1825211 | - | 58 | - | - | Antitoxin |
JMUB1273_RS09080 | 1825249..1825350 | + | 102 | WP_001791232.1 | hypothetical protein | - |
JMUB1273_RS09085 | 1825328..1825510 | - | 183 | Protein_1709 | transposase | - |
JMUB1273_RS09090 | 1825698..1826072 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
JMUB1273_RS09095 | 1826094..1826441 | - | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
JMUB1273_RS09100 | 1826651..1827094 | - | 444 | WP_000742594.1 | DUF1433 domain-containing protein | - |
JMUB1273_RS09105 | 1827742..1828860 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1817512..1845871 | 28359 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T32421 WP_001801861.1 NZ_AP018922:1825031-1825126 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T32421 NZ_AP018922:1825031-1825126 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT32421 NZ_AP018922:c1825211-1825154 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|