Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1695595..1695815 Replicon chromosome
Accession NZ_AP018808
Organism Escherichia coli strain E2865

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag EL389_RS09095 Protein ID WP_000170954.1
Coordinates 1695595..1695702 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1695752..1695815 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
EL389_RS09070 1691439..1692521 + 1083 WP_000804726.1 peptide chain release factor 1 -
EL389_RS09075 1692521..1693354 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
EL389_RS09080 1693351..1693743 + 393 WP_000200378.1 invasion regulator SirB2 -
EL389_RS09085 1693747..1694556 + 810 WP_001257045.1 invasion regulator SirB1 -
EL389_RS09090 1694592..1695446 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
EL389_RS09095 1695595..1695702 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1695752..1695815 + 64 NuclAT_32 - Antitoxin
- 1695752..1695815 + 64 NuclAT_32 - Antitoxin
- 1695752..1695815 + 64 NuclAT_32 - Antitoxin
- 1695752..1695815 + 64 NuclAT_32 - Antitoxin
- 1695752..1695815 + 64 NuclAT_35 - Antitoxin
- 1695752..1695815 + 64 NuclAT_35 - Antitoxin
- 1695752..1695815 + 64 NuclAT_35 - Antitoxin
- 1695752..1695815 + 64 NuclAT_35 - Antitoxin
- 1695752..1695815 + 64 NuclAT_38 - Antitoxin
- 1695752..1695815 + 64 NuclAT_38 - Antitoxin
- 1695752..1695815 + 64 NuclAT_38 - Antitoxin
- 1695752..1695815 + 64 NuclAT_38 - Antitoxin
- 1695752..1695815 + 64 NuclAT_41 - Antitoxin
- 1695752..1695815 + 64 NuclAT_41 - Antitoxin
- 1695752..1695815 + 64 NuclAT_41 - Antitoxin
- 1695752..1695815 + 64 NuclAT_41 - Antitoxin
- 1695752..1695815 + 64 NuclAT_44 - Antitoxin
- 1695752..1695815 + 64 NuclAT_44 - Antitoxin
- 1695752..1695815 + 64 NuclAT_44 - Antitoxin
- 1695752..1695815 + 64 NuclAT_44 - Antitoxin
- 1695752..1695815 + 64 NuclAT_47 - Antitoxin
- 1695752..1695815 + 64 NuclAT_47 - Antitoxin
- 1695752..1695815 + 64 NuclAT_47 - Antitoxin
- 1695752..1695815 + 64 NuclAT_47 - Antitoxin
EL389_RS09100 1696130..1696237 - 108 WP_000170959.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1696290..1696351 + 62 NuclAT_31 - -
- 1696290..1696351 + 62 NuclAT_31 - -
- 1696290..1696351 + 62 NuclAT_31 - -
- 1696290..1696351 + 62 NuclAT_31 - -
- 1696290..1696351 + 62 NuclAT_34 - -
- 1696290..1696351 + 62 NuclAT_34 - -
- 1696290..1696351 + 62 NuclAT_34 - -
- 1696290..1696351 + 62 NuclAT_34 - -
- 1696290..1696351 + 62 NuclAT_37 - -
- 1696290..1696351 + 62 NuclAT_37 - -
- 1696290..1696351 + 62 NuclAT_37 - -
- 1696290..1696351 + 62 NuclAT_37 - -
- 1696290..1696351 + 62 NuclAT_40 - -
- 1696290..1696351 + 62 NuclAT_40 - -
- 1696290..1696351 + 62 NuclAT_40 - -
- 1696290..1696351 + 62 NuclAT_40 - -
- 1696290..1696351 + 62 NuclAT_43 - -
- 1696290..1696351 + 62 NuclAT_43 - -
- 1696290..1696351 + 62 NuclAT_43 - -
- 1696290..1696351 + 62 NuclAT_43 - -
- 1696290..1696351 + 62 NuclAT_46 - -
- 1696290..1696351 + 62 NuclAT_46 - -
- 1696290..1696351 + 62 NuclAT_46 - -
- 1696290..1696351 + 62 NuclAT_46 - -
- 1696290..1696353 + 64 NuclAT_17 - -
- 1696290..1696353 + 64 NuclAT_17 - -
- 1696290..1696353 + 64 NuclAT_17 - -
- 1696290..1696353 + 64 NuclAT_17 - -
- 1696290..1696353 + 64 NuclAT_19 - -
- 1696290..1696353 + 64 NuclAT_19 - -
- 1696290..1696353 + 64 NuclAT_19 - -
- 1696290..1696353 + 64 NuclAT_19 - -
- 1696290..1696353 + 64 NuclAT_21 - -
- 1696290..1696353 + 64 NuclAT_21 - -
- 1696290..1696353 + 64 NuclAT_21 - -
- 1696290..1696353 + 64 NuclAT_21 - -
- 1696290..1696353 + 64 NuclAT_23 - -
- 1696290..1696353 + 64 NuclAT_23 - -
- 1696290..1696353 + 64 NuclAT_23 - -
- 1696290..1696353 + 64 NuclAT_23 - -
- 1696290..1696353 + 64 NuclAT_25 - -
- 1696290..1696353 + 64 NuclAT_25 - -
- 1696290..1696353 + 64 NuclAT_25 - -
- 1696290..1696353 + 64 NuclAT_25 - -
- 1696290..1696353 + 64 NuclAT_27 - -
- 1696290..1696353 + 64 NuclAT_27 - -
- 1696290..1696353 + 64 NuclAT_27 - -
- 1696290..1696353 + 64 NuclAT_27 - -
EL389_RS09105 1696666..1696773 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1696821..1696886 + 66 NuclAT_30 - -
- 1696821..1696886 + 66 NuclAT_30 - -
- 1696821..1696886 + 66 NuclAT_30 - -
- 1696821..1696886 + 66 NuclAT_30 - -
- 1696821..1696886 + 66 NuclAT_33 - -
- 1696821..1696886 + 66 NuclAT_33 - -
- 1696821..1696886 + 66 NuclAT_33 - -
- 1696821..1696886 + 66 NuclAT_33 - -
- 1696821..1696886 + 66 NuclAT_36 - -
- 1696821..1696886 + 66 NuclAT_36 - -
- 1696821..1696886 + 66 NuclAT_36 - -
- 1696821..1696886 + 66 NuclAT_36 - -
- 1696821..1696886 + 66 NuclAT_39 - -
- 1696821..1696886 + 66 NuclAT_39 - -
- 1696821..1696886 + 66 NuclAT_39 - -
- 1696821..1696886 + 66 NuclAT_39 - -
- 1696821..1696886 + 66 NuclAT_42 - -
- 1696821..1696886 + 66 NuclAT_42 - -
- 1696821..1696886 + 66 NuclAT_42 - -
- 1696821..1696886 + 66 NuclAT_42 - -
- 1696821..1696886 + 66 NuclAT_45 - -
- 1696821..1696886 + 66 NuclAT_45 - -
- 1696821..1696886 + 66 NuclAT_45 - -
- 1696821..1696886 + 66 NuclAT_45 - -
- 1696821..1696888 + 68 NuclAT_16 - -
- 1696821..1696888 + 68 NuclAT_16 - -
- 1696821..1696888 + 68 NuclAT_16 - -
- 1696821..1696888 + 68 NuclAT_16 - -
- 1696821..1696888 + 68 NuclAT_18 - -
- 1696821..1696888 + 68 NuclAT_18 - -
- 1696821..1696888 + 68 NuclAT_18 - -
- 1696821..1696888 + 68 NuclAT_18 - -
- 1696821..1696888 + 68 NuclAT_20 - -
- 1696821..1696888 + 68 NuclAT_20 - -
- 1696821..1696888 + 68 NuclAT_20 - -
- 1696821..1696888 + 68 NuclAT_20 - -
- 1696821..1696888 + 68 NuclAT_22 - -
- 1696821..1696888 + 68 NuclAT_22 - -
- 1696821..1696888 + 68 NuclAT_22 - -
- 1696821..1696888 + 68 NuclAT_22 - -
- 1696821..1696888 + 68 NuclAT_24 - -
- 1696821..1696888 + 68 NuclAT_24 - -
- 1696821..1696888 + 68 NuclAT_24 - -
- 1696821..1696888 + 68 NuclAT_24 - -
- 1696821..1696888 + 68 NuclAT_26 - -
- 1696821..1696888 + 68 NuclAT_26 - -
- 1696821..1696888 + 68 NuclAT_26 - -
- 1696821..1696888 + 68 NuclAT_26 - -
EL389_RS09110 1697178..1698278 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
EL389_RS09115 1698548..1698778 + 231 WP_001146442.1 putative cation transport regulator ChaB -
EL389_RS09120 1698936..1699631 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
EL389_RS09125 1699675..1700028 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T32365 WP_000170954.1 NZ_AP018808:c1695702-1695595 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T32365 NZ_AP018808:c1695702-1695595 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 64 bp

>AT32365 NZ_AP018808:1695752-1695815 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References