Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 1695595..1695815 | Replicon | chromosome |
Accession | NZ_AP018808 | ||
Organism | Escherichia coli strain E2865 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1PGT3 |
Locus tag | EL389_RS09095 | Protein ID | WP_000170954.1 |
Coordinates | 1695595..1695702 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 1695752..1695815 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL389_RS09070 | 1691439..1692521 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
EL389_RS09075 | 1692521..1693354 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
EL389_RS09080 | 1693351..1693743 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
EL389_RS09085 | 1693747..1694556 | + | 810 | WP_001257045.1 | invasion regulator SirB1 | - |
EL389_RS09090 | 1694592..1695446 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
EL389_RS09095 | 1695595..1695702 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 1695752..1695815 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_32 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_35 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_38 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_41 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_44 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_44 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_44 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_44 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_47 | - | Antitoxin |
- | 1695752..1695815 | + | 64 | NuclAT_47 | - | Antitoxin |
EL389_RS09100 | 1696130..1696237 | - | 108 | WP_000170959.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1696290..1696351 | + | 62 | NuclAT_31 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_31 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_31 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_31 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_34 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_34 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_34 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_34 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_37 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_37 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_37 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_37 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_40 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_40 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_40 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_40 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_43 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_43 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_43 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_43 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_46 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_46 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_46 | - | - |
- | 1696290..1696351 | + | 62 | NuclAT_46 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_17 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_17 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_17 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_17 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_19 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_19 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_19 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_19 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_21 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_21 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_21 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_21 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_23 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_23 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_23 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_23 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_25 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_25 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_25 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_25 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_27 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_27 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_27 | - | - |
- | 1696290..1696353 | + | 64 | NuclAT_27 | - | - |
EL389_RS09105 | 1696666..1696773 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 1696821..1696886 | + | 66 | NuclAT_30 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_30 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_30 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_30 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_33 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_33 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_33 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_33 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_36 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_36 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_36 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_36 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_39 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_39 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_39 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_39 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_42 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_42 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_42 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_42 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_45 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_45 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_45 | - | - |
- | 1696821..1696886 | + | 66 | NuclAT_45 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_16 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_16 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_16 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_16 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_18 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_18 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_18 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_18 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_20 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_20 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_20 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_20 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_22 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_22 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_22 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_22 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_24 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_24 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_24 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_24 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_26 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_26 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_26 | - | - |
- | 1696821..1696888 | + | 68 | NuclAT_26 | - | - |
EL389_RS09110 | 1697178..1698278 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
EL389_RS09115 | 1698548..1698778 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
EL389_RS09120 | 1698936..1699631 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
EL389_RS09125 | 1699675..1700028 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T32365 WP_000170954.1 NZ_AP018808:c1695702-1695595 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T32365 NZ_AP018808:c1695702-1695595 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT32365 NZ_AP018808:1695752-1695815 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|