Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 70195..70448 | Replicon | plasmid pE2855-5 |
Accession | NZ_AP018801 | ||
Organism | Escherichia coli strain E2855 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | MCREHEC_RS31260 | Protein ID | WP_001312851.1 |
Coordinates | 70299..70448 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 70195..70254 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MCREHEC_RS31335 | 66058..66510 | + | 453 | Protein_85 | hypothetical protein | - |
MCREHEC_RS31225 | 66567..67780 | + | 1214 | WP_162829202.1 | IS3 family transposase | - |
MCREHEC_RS31230 | 67821..68078 | + | 258 | Protein_87 | YadA-like family protein | - |
MCREHEC_RS31235 | 68080..68541 | + | 462 | WP_021553165.1 | thermonuclease family protein | - |
MCREHEC_RS31240 | 68587..68796 | + | 210 | WP_001333231.1 | hemolysin expression modulator Hha | - |
MCREHEC_RS31245 | 68834..69424 | + | 591 | WP_078183909.1 | DUF2726 domain-containing protein | - |
MCREHEC_RS31250 | 69579..70052 | + | 474 | WP_078183908.1 | hypothetical protein | - |
- | 70195..70254 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 70195..70254 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 70195..70254 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 70195..70254 | - | 60 | NuclAT_1 | - | Antitoxin |
MCREHEC_RS31260 | 70299..70448 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
MCREHEC_RS31265 | 70732..70989 | + | 258 | WP_021553168.1 | replication regulatory protein RepA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..71289 | 71289 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T32319 WP_001312851.1 NZ_AP018801:70299-70448 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T32319 NZ_AP018801:70299-70448 [Escherichia coli]
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
ATGACGAAGTATGCCCTTATCGGGTTGCTCGCCGTGTGCGCCACGGTGTTGTGTTTTTCACTGATATTCAGGGAACGGTT
ATGTGAGCTGAATATTCACAGGGGAAATACAGTGGTGCAGGTAACTCTGGCCTACGAAGCACGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT32319 NZ_AP018801:c70254-70195 [Escherichia coli]
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
AATGTACTTCATGCAGACCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|