Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 36733..37003 | Replicon | plasmid pSK1144 |
Accession | NZ_AP018785 | ||
Organism | Escherichia coli strain SK1144 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | DAECLI1_RS25160 | Protein ID | WP_001312861.1 |
Coordinates | 36845..37003 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 36733..36796 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
DAECLI1_RS25135 | 32503..33030 | + | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
DAECLI1_RS25140 | 33088..33321 | + | 234 | WP_000006003.1 | DUF905 family protein | - |
DAECLI1_RS25145 | 33382..35346 | + | 1965 | WP_000117316.1 | ParB/RepB/Spo0J family partition protein | - |
DAECLI1_RS25150 | 35415..35849 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
DAECLI1_RS25155 | 35846..36565 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 36577..36801 | + | 225 | NuclAT_0 | - | - |
- | 36577..36801 | + | 225 | NuclAT_0 | - | - |
- | 36577..36801 | + | 225 | NuclAT_0 | - | - |
- | 36577..36801 | + | 225 | NuclAT_0 | - | - |
DAECLI1_RS26305 | 36586..36765 | - | 180 | WP_001309233.1 | hypothetical protein | - |
- | 36733..36796 | - | 64 | - | - | Antitoxin |
DAECLI1_RS25160 | 36845..37003 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
DAECLI1_RS25180 | 37919..38215 | + | 297 | WP_001272251.1 | hypothetical protein | - |
DAECLI1_RS25185 | 38326..39147 | + | 822 | WP_021549731.1 | DUF945 domain-containing protein | - |
DAECLI1_RS25190 | 39444..40091 | - | 648 | Protein_48 | transglycosylase SLT domain-containing protein | - |
DAECLI1_RS25195 | 40367..40750 | + | 384 | WP_001151529.1 | relaxosome protein TraM | - |
DAECLI1_RS25200 | 40942..41589 | + | 648 | WP_000332523.1 | transcriptional regulator TraJ family protein | - |
DAECLI1_RS25205 | 41697..41936 | + | 240 | WP_042018283.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | senB | 1..169561 | 169561 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T32263 WP_001312861.1 NZ_AP018785:36845-37003 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T32263 NZ_AP018785:36845-37003 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 64 bp
>AT32263 NZ_AP018785:c36796-36733 [Escherichia coli]
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
GACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|