Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2264868..2265089 Replicon chromosome
Accession NZ_AP018784
Organism Escherichia coli strain SK1144

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag DAECLI1_RS11325 Protein ID WP_001531632.1
Coordinates 2264868..2264975 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2265023..2265089 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
DAECLI1_RS11300 2260712..2261794 + 1083 WP_000804726.1 peptide chain release factor 1 -
DAECLI1_RS11305 2261794..2262627 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
DAECLI1_RS11310 2262624..2263016 + 393 WP_000200375.1 invasion regulator SirB2 -
DAECLI1_RS11315 2263020..2263829 + 810 WP_001257044.1 invasion regulator SirB1 -
DAECLI1_RS11320 2263865..2264719 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
DAECLI1_RS11325 2264868..2264975 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2265023..2265089 + 67 NuclAT_10 - Antitoxin
- 2265023..2265089 + 67 NuclAT_10 - Antitoxin
- 2265023..2265089 + 67 NuclAT_10 - Antitoxin
- 2265023..2265089 + 67 NuclAT_10 - Antitoxin
- 2265023..2265089 + 67 NuclAT_5 - Antitoxin
- 2265023..2265089 + 67 NuclAT_5 - Antitoxin
- 2265023..2265089 + 67 NuclAT_5 - Antitoxin
- 2265023..2265089 + 67 NuclAT_5 - Antitoxin
- 2265023..2265089 + 67 NuclAT_6 - Antitoxin
- 2265023..2265089 + 67 NuclAT_6 - Antitoxin
- 2265023..2265089 + 67 NuclAT_6 - Antitoxin
- 2265023..2265089 + 67 NuclAT_6 - Antitoxin
- 2265023..2265089 + 67 NuclAT_7 - Antitoxin
- 2265023..2265089 + 67 NuclAT_7 - Antitoxin
- 2265023..2265089 + 67 NuclAT_7 - Antitoxin
- 2265023..2265089 + 67 NuclAT_7 - Antitoxin
- 2265023..2265089 + 67 NuclAT_8 - Antitoxin
- 2265023..2265089 + 67 NuclAT_8 - Antitoxin
- 2265023..2265089 + 67 NuclAT_8 - Antitoxin
- 2265023..2265089 + 67 NuclAT_8 - Antitoxin
- 2265023..2265089 + 67 NuclAT_9 - Antitoxin
- 2265023..2265089 + 67 NuclAT_9 - Antitoxin
- 2265023..2265089 + 67 NuclAT_9 - Antitoxin
- 2265023..2265089 + 67 NuclAT_9 - Antitoxin
- 2265025..2265088 + 64 NuclAT_12 - -
- 2265025..2265088 + 64 NuclAT_12 - -
- 2265025..2265088 + 64 NuclAT_12 - -
- 2265025..2265088 + 64 NuclAT_12 - -
- 2265025..2265088 + 64 NuclAT_13 - -
- 2265025..2265088 + 64 NuclAT_13 - -
- 2265025..2265088 + 64 NuclAT_13 - -
- 2265025..2265088 + 64 NuclAT_13 - -
- 2265025..2265088 + 64 NuclAT_14 - -
- 2265025..2265088 + 64 NuclAT_14 - -
- 2265025..2265088 + 64 NuclAT_14 - -
- 2265025..2265088 + 64 NuclAT_14 - -
- 2265025..2265088 + 64 NuclAT_15 - -
- 2265025..2265088 + 64 NuclAT_15 - -
- 2265025..2265088 + 64 NuclAT_15 - -
- 2265025..2265088 + 64 NuclAT_15 - -
- 2265025..2265088 + 64 NuclAT_16 - -
- 2265025..2265088 + 64 NuclAT_16 - -
- 2265025..2265088 + 64 NuclAT_16 - -
- 2265025..2265088 + 64 NuclAT_16 - -
- 2265025..2265088 + 64 NuclAT_17 - -
- 2265025..2265088 + 64 NuclAT_17 - -
- 2265025..2265088 + 64 NuclAT_17 - -
- 2265025..2265088 + 64 NuclAT_17 - -
- 2265025..2265090 + 66 NuclAT_18 - -
- 2265025..2265090 + 66 NuclAT_18 - -
- 2265025..2265090 + 66 NuclAT_18 - -
- 2265025..2265090 + 66 NuclAT_18 - -
- 2265025..2265090 + 66 NuclAT_19 - -
- 2265025..2265090 + 66 NuclAT_19 - -
- 2265025..2265090 + 66 NuclAT_19 - -
- 2265025..2265090 + 66 NuclAT_19 - -
- 2265025..2265090 + 66 NuclAT_20 - -
- 2265025..2265090 + 66 NuclAT_20 - -
- 2265025..2265090 + 66 NuclAT_20 - -
- 2265025..2265090 + 66 NuclAT_20 - -
- 2265025..2265090 + 66 NuclAT_21 - -
- 2265025..2265090 + 66 NuclAT_21 - -
- 2265025..2265090 + 66 NuclAT_21 - -
- 2265025..2265090 + 66 NuclAT_21 - -
- 2265025..2265090 + 66 NuclAT_22 - -
- 2265025..2265090 + 66 NuclAT_22 - -
- 2265025..2265090 + 66 NuclAT_22 - -
- 2265025..2265090 + 66 NuclAT_22 - -
- 2265025..2265090 + 66 NuclAT_23 - -
- 2265025..2265090 + 66 NuclAT_23 - -
- 2265025..2265090 + 66 NuclAT_23 - -
- 2265025..2265090 + 66 NuclAT_23 - -
DAECLI1_RS11330 2265380..2266480 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
DAECLI1_RS11335 2266750..2266989 + 240 WP_000120702.1 putative cation transport regulator ChaB -
DAECLI1_RS11340 2267138..2267833 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
DAECLI1_RS11345 2267877..2268230 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
DAECLI1_RS11350 2268415..2269809 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T32243 WP_001531632.1 NZ_AP018784:c2264975-2264868 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T32243 NZ_AP018784:c2264975-2264868 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT32243 NZ_AP018784:2265023-2265089 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References