Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2437217..2437401 | Replicon | chromosome |
Accession | NZ_AP018562 | ||
Organism | Staphylococcus argenteus strain 58113 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | SA58113_RS12080 | Protein ID | WP_000482653.1 |
Coordinates | 2437294..2437401 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2437217..2437277 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SA58113_RS12065 | 2433069..2434802 | - | 1734 | WP_031787186.1 | ABC transporter ATP-binding protein/permease | - |
SA58113_RS12070 | 2434827..2436590 | - | 1764 | WP_031787187.1 | ABC transporter ATP-binding protein/permease | - |
- | 2437217..2437277 | + | 61 | - | - | Antitoxin |
SA58113_RS12080 | 2437294..2437401 | - | 108 | WP_000482653.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SA58113_RS12085 | 2437535..2437921 | - | 387 | WP_000779346.1 | flippase GtxA | - |
SA58113_RS12090 | 2438189..2439331 | + | 1143 | WP_031787188.1 | glycerate kinase | - |
SA58113_RS12095 | 2439390..2440049 | + | 660 | WP_000831306.1 | membrane protein | - |
SA58113_RS12100 | 2440234..2441445 | + | 1212 | WP_031787189.1 | multidrug effflux MFS transporter | - |
SA58113_RS12105 | 2441561..2442040 | - | 480 | WP_031787190.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4025.81 Da Isoelectric Point: 11.0582
>T31903 WP_000482653.1 NZ_AP018562:c2437401-2437294 [Staphylococcus argenteus]
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTTAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T31903 NZ_AP018562:c2437401-2437294 [Staphylococcus argenteus]
ATGTTCAATTTATTGATTAACATCATGACTACAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTGATTAACATCATGACTACAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT31903 NZ_AP018562:2437217-2437277 [Staphylococcus argenteus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|