Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 301803..301997 | Replicon | chromosome |
Accession | NZ_AP018543 | ||
Organism | Enterococcus faecalis strain KUB3007 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | EL279_RS16205 | Protein ID | WP_162781186.1 |
Coordinates | 301902..301997 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 301803..301867 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL279_RS01605 | 297421..299163 | + | 1743 | WP_172596813.1 | PTS transporter subunit EIIC | - |
EL279_RS01610 | 299154..301187 | + | 2034 | WP_002361171.1 | transcription antiterminator | - |
EL279_RS01615 | 301198..301632 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 301803..301867 | + | 65 | - | - | Antitoxin |
EL279_RS16205 | 301902..301997 | - | 96 | WP_162781186.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EL279_RS01625 | 302243..304015 | + | 1773 | WP_002387897.1 | PTS mannitol transporter subunit IICBA | - |
EL279_RS01630 | 304030..304467 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
EL279_RS01635 | 304482..305636 | + | 1155 | WP_002395429.1 | mannitol-1-phosphate 5-dehydrogenase | - |
EL279_RS01640 | 305703..306818 | - | 1116 | WP_033785759.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3658.53 Da Isoelectric Point: 8.6635
>T31866 WP_162781186.1 NZ_AP018543:c301997-301902 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNKE
Download Length: 96 bp
>T31866 NZ_AP018543:c301997-301902 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACAAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACAAGGAATAA
Antitoxin
Download Length: 65 bp
>AT31866 NZ_AP018543:301803-301867 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|