Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-ratA/Fst(toxin) |
Location | 3279..3520 | Replicon | plasmid pKUB3006-1 |
Accession | NZ_AP018539 | ||
Organism | Enterococcus faecalis strain KUB3006 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | EL240_RS14685 | Protein ID | WP_002360667.1 |
Coordinates | 3279..3389 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 3429..3520 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EL240_RS14655 | 76..696 | + | 621 | WP_161971471.1 | recombinase family protein | - |
EL240_RS14660 | 713..997 | + | 285 | WP_002394798.1 | hypothetical protein | - |
EL240_RS14665 | 999..1232 | + | 234 | WP_002394799.1 | hypothetical protein | - |
EL240_RS14670 | 1392..1646 | - | 255 | WP_002394800.1 | hypothetical protein | - |
EL240_RS14675 | 1763..2431 | - | 669 | WP_002403283.1 | CPBP family intramembrane metalloprotease | - |
EL240_RS14680 | 2467..2784 | - | 318 | WP_002394802.1 | heavy metal-binding domain-containing protein | - |
EL240_RS14685 | 3279..3389 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 3429..3520 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 3429..3520 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 3429..3520 | - | 92 | NuclAT_0 | - | Antitoxin |
- | 3429..3520 | - | 92 | NuclAT_0 | - | Antitoxin |
EL240_RS14690 | 3629..3928 | + | 300 | WP_126300999.1 | type III secretion system protein PrgN | - |
EL240_RS14695 | 4713..5255 | - | 543 | WP_086321354.1 | hypothetical protein | - |
EL240_RS14700 | 5265..6116 | - | 852 | WP_002362419.1 | ParA family protein | - |
EL240_RS14705 | 6779..7795 | + | 1017 | WP_033593833.1 | replication initiator protein A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(B) / aph(3')-III / dfrG / ant(6)-Ia / lsa(E) / lnu(B) / aac(6')-aph(2'') | prgB/asc10 | 1..106370 | 106370 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T31860 WP_002360667.1 NZ_AP018539:3279-3389 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
>T31860 NZ_AP018539:3279-3389 [Enterococcus faecalis]
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
GTGTTATTTGTGAAAGATTTAATGTCGTTGGTTATCGCACCGATCTTTGTAGGATTGGTTCTGGAAATGATTTCTCGTGT
GTTGGACGAGGAAGACGATAACCGAAAGTAA
Antitoxin
Download Length: 92 bp
>AT31860 NZ_AP018539:c3520-3429 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|