Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2170862..2171087 | Replicon | chromosome |
Accession | NZ_AP018488 | ||
Organism | Escherichia coli O157:H7 strain PV15-279 |
Toxin (Protein)
Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
Locus tag | ECpv15279_RS11215 | Protein ID | WP_000813258.1 |
Coordinates | 2170862..2171017 (-) | Length | 52 a.a. |
Antitoxin (RNA)
Gene name | sokW | ||
Locus tag | - | ||
Coordinates | 2171029..2171087 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
ECpv15279_RS11180 | 2166747..2167460 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
ECpv15279_RS11185 | 2167596..2167793 | - | 198 | WP_000917763.1 | hypothetical protein | - |
ECpv15279_RS11190 | 2168018..2168572 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
ECpv15279_RS11195 | 2168581..2168940 | - | 360 | WP_001217447.1 | RusA family crossover junction endodeoxyribonuclease | - |
ECpv15279_RS11200 | 2168953..2170002 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
ECpv15279_RS11205 | 2170004..2170276 | - | 273 | WP_000191872.1 | hypothetical protein | - |
ECpv15279_RS11210 | 2170398..2170742 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
ECpv15279_RS11215 | 2170862..2171017 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 2171029..2171087 | + | 59 | - | - | Antitoxin |
ECpv15279_RS11220 | 2171308..2171865 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
ECpv15279_RS11225 | 2171867..2172085 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
ECpv15279_RS11230 | 2172213..2172524 | - | 312 | WP_001289672.1 | hypothetical protein | - |
ECpv15279_RS11235 | 2172517..2172732 | - | 216 | WP_050554342.1 | hypothetical protein | - |
ECpv15279_RS11240 | 2172721..2173934 | + | 1214 | WP_162829202.1 | IS3 family transposase | - |
ECpv15279_RS11245 | 2173976..2174509 | + | 534 | Protein_2127 | tyrosine-type recombinase/integrase | - |
ECpv15279_RS11255 | 2174697..2175716 | - | 1020 | WP_000836042.1 | Zn-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | nleG7' / paa / nleC / nleC / stx2B / stx2A / espM1 / nleH2 / nleA/espI | 1989300..2174509 | 185209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T31810 WP_000813258.1 NZ_AP018488:c2171017-2170862 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T31810 NZ_AP018488:c2171017-2170862 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT31810 NZ_AP018488:2171029-2171087 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|