Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1609084..1609298 Replicon chromosome
Accession NZ_AP018488
Organism Escherichia coli O157:H7 strain PV15-279

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag ECpv15279_RS08010 Protein ID WP_000170963.1
Coordinates 1609084..1609191 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1609239..1609298 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
ECpv15279_RS07980 1604393..1605475 + 1083 WP_000804726.1 peptide chain release factor 1 -
ECpv15279_RS07985 1605475..1606308 + 834 WP_000456464.1 peptide chain release factor N(5)-glutamine methyltransferase -
ECpv15279_RS07990 1606305..1606697 + 393 WP_000200379.1 invasion regulator SirB2 -
ECpv15279_RS07995 1606701..1607510 + 810 WP_001257044.1 invasion regulator SirB1 -
ECpv15279_RS08000 1607546..1608400 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
ECpv15279_RS08005 1608548..1608655 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1608708..1608769 + 62 NuclAT_24 - -
- 1608708..1608769 + 62 NuclAT_24 - -
- 1608708..1608769 + 62 NuclAT_24 - -
- 1608708..1608769 + 62 NuclAT_24 - -
- 1608708..1608769 + 62 NuclAT_26 - -
- 1608708..1608769 + 62 NuclAT_26 - -
- 1608708..1608769 + 62 NuclAT_26 - -
- 1608708..1608769 + 62 NuclAT_26 - -
- 1608708..1608769 + 62 NuclAT_28 - -
- 1608708..1608769 + 62 NuclAT_28 - -
- 1608708..1608769 + 62 NuclAT_28 - -
- 1608708..1608769 + 62 NuclAT_28 - -
- 1608708..1608769 + 62 NuclAT_30 - -
- 1608708..1608769 + 62 NuclAT_30 - -
- 1608708..1608769 + 62 NuclAT_30 - -
- 1608708..1608769 + 62 NuclAT_30 - -
- 1608708..1608769 + 62 NuclAT_32 - -
- 1608708..1608769 + 62 NuclAT_32 - -
- 1608708..1608769 + 62 NuclAT_32 - -
- 1608708..1608769 + 62 NuclAT_32 - -
- 1608708..1608770 + 63 NuclAT_17 - -
- 1608708..1608770 + 63 NuclAT_17 - -
- 1608708..1608770 + 63 NuclAT_17 - -
- 1608708..1608770 + 63 NuclAT_17 - -
- 1608708..1608770 + 63 NuclAT_18 - -
- 1608708..1608770 + 63 NuclAT_18 - -
- 1608708..1608770 + 63 NuclAT_18 - -
- 1608708..1608770 + 63 NuclAT_18 - -
- 1608708..1608770 + 63 NuclAT_19 - -
- 1608708..1608770 + 63 NuclAT_19 - -
- 1608708..1608770 + 63 NuclAT_19 - -
- 1608708..1608770 + 63 NuclAT_19 - -
- 1608708..1608770 + 63 NuclAT_20 - -
- 1608708..1608770 + 63 NuclAT_20 - -
- 1608708..1608770 + 63 NuclAT_20 - -
- 1608708..1608770 + 63 NuclAT_20 - -
- 1608708..1608770 + 63 NuclAT_22 - -
- 1608708..1608770 + 63 NuclAT_22 - -
- 1608708..1608770 + 63 NuclAT_22 - -
- 1608708..1608770 + 63 NuclAT_22 - -
- 1608708..1608770 + 63 NuclAT_23 - -
- 1608708..1608770 + 63 NuclAT_23 - -
- 1608708..1608770 + 63 NuclAT_23 - -
- 1608708..1608770 + 63 NuclAT_23 - -
ECpv15279_RS08010 1609084..1609191 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1609239..1609298 + 60 NuclAT_25 - Antitoxin
- 1609239..1609298 + 60 NuclAT_25 - Antitoxin
- 1609239..1609298 + 60 NuclAT_25 - Antitoxin
- 1609239..1609298 + 60 NuclAT_25 - Antitoxin
- 1609239..1609298 + 60 NuclAT_27 - Antitoxin
- 1609239..1609298 + 60 NuclAT_27 - Antitoxin
- 1609239..1609298 + 60 NuclAT_27 - Antitoxin
- 1609239..1609298 + 60 NuclAT_27 - Antitoxin
- 1609239..1609298 + 60 NuclAT_29 - Antitoxin
- 1609239..1609298 + 60 NuclAT_29 - Antitoxin
- 1609239..1609298 + 60 NuclAT_29 - Antitoxin
- 1609239..1609298 + 60 NuclAT_29 - Antitoxin
- 1609239..1609298 + 60 NuclAT_31 - Antitoxin
- 1609239..1609298 + 60 NuclAT_31 - Antitoxin
- 1609239..1609298 + 60 NuclAT_31 - Antitoxin
- 1609239..1609298 + 60 NuclAT_31 - Antitoxin
- 1609239..1609298 + 60 NuclAT_33 - Antitoxin
- 1609239..1609298 + 60 NuclAT_33 - Antitoxin
- 1609239..1609298 + 60 NuclAT_33 - Antitoxin
- 1609239..1609298 + 60 NuclAT_33 - Antitoxin
ECpv15279_RS08015 1609590..1610690 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
ECpv15279_RS08020 1610960..1611190 + 231 WP_001146444.1 putative cation transport regulator ChaB -
ECpv15279_RS08025 1611351..1612046 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
ECpv15279_RS08030 1612090..1612443 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
ECpv15279_RS08035 1612629..1614023 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T31803 WP_000170963.1 NZ_AP018488:c1609191-1609084 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T31803 NZ_AP018488:c1609191-1609084 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT31803 NZ_AP018488:1609239-1609298 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References