Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2282105..2282322 | Replicon | chromosome |
Accession | NZ_AP018349 | ||
Organism | Staphylococcus aureus strain GN1 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | D8S83_RS11645 | Protein ID | WP_001802298.1 |
Coordinates | 2282218..2282322 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2282105..2282160 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D8S83_RS11625 | 2278238..2278903 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
D8S83_RS11630 | 2279055..2279375 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
D8S83_RS11635 | 2279377..2280354 | + | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
D8S83_RS11640 | 2280620..2281711 | + | 1092 | WP_020977458.1 | hypothetical protein | - |
- | 2282105..2282160 | + | 56 | - | - | Antitoxin |
D8S83_RS11645 | 2282218..2282322 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
D8S83_RS14340 | 2282483..2282986 | - | 504 | Protein_2159 | recombinase family protein | - |
D8S83_RS11655 | 2283034..2284326 | + | 1293 | WP_020977460.1 | IS21 family transposase | - |
D8S83_RS11660 | 2284319..2285080 | + | 762 | WP_001066124.1 | IS21-like element helper ATPase IstB | - |
D8S83_RS14400 | 2285216..2286352 | - | 1137 | Protein_2162 | SAP domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2284319..2285080 | 761 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T31760 WP_001802298.1 NZ_AP018349:c2282322-2282218 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T31760 NZ_AP018349:c2282322-2282218 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT31760 NZ_AP018349:2282105-2282160 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|