Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1971053..1971233 | Replicon | chromosome |
Accession | NZ_AP018349 | ||
Organism | Staphylococcus aureus strain GN1 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | D8S83_RS09810 | Protein ID | WP_001801861.1 |
Coordinates | 1971053..1971148 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1971176..1971233 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D8S83_RS09765 | 1966517..1967515 | + | 999 | WP_120173197.1 | DUF4352 domain-containing protein | - |
D8S83_RS09770 | 1967591..1968217 | + | 627 | WP_000669045.1 | hypothetical protein | - |
D8S83_RS09775 | 1968258..1968599 | + | 342 | WP_000627534.1 | DUF3969 family protein | - |
D8S83_RS09780 | 1968700..1969272 | + | 573 | WP_000414218.1 | hypothetical protein | - |
D8S83_RS09785 | 1969602..1969787 | - | 186 | WP_000809860.1 | hypothetical protein | - |
D8S83_RS09790 | 1969789..1969965 | - | 177 | WP_000375478.1 | hypothetical protein | - |
D8S83_RS09795 | 1969976..1970265 | - | 290 | Protein_1850 | hypothetical protein | - |
D8S83_RS09800 | 1970433..1970666 | - | 234 | Protein_1851 | IS3 family transposase | - |
D8S83_RS09805 | 1970672..1970908 | - | 237 | WP_000251969.1 | IS3 family transposase | - |
D8S83_RS09810 | 1971053..1971148 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1971176..1971233 | - | 58 | - | - | Antitoxin |
D8S83_RS09820 | 1972089..1972531 | - | 443 | Protein_1854 | DUF1433 domain-containing protein | - |
D8S83_RS09825 | 1972531..1972974 | - | 444 | WP_000731420.1 | DUF1433 domain-containing protein | - |
D8S83_RS09830 | 1972974..1973417 | - | 444 | WP_000747798.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1970672..1970908 | 236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T31754 WP_001801861.1 NZ_AP018349:1971053-1971148 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T31754 NZ_AP018349:1971053-1971148 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT31754 NZ_AP018349:c1971233-1971176 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|