Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2425831..2426015 | Replicon | chromosome |
Accession | NZ_AP017922 | ||
Organism | Staphylococcus aureus strain JP02758 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | JP49775_RS12215 | Protein ID | WP_000482647.1 |
Coordinates | 2425908..2426015 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2425831..2425891 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JP49775_RS12200 | 2421274..2421452 | - | 179 | Protein_2310 | hypothetical protein | - |
JP49775_RS12205 | 2421683..2423416 | - | 1734 | WP_000486511.1 | ABC transporter ATP-binding protein/permease | - |
JP49775_RS12210 | 2423441..2425204 | - | 1764 | WP_001064818.1 | ABC transporter ATP-binding protein/permease | - |
- | 2425831..2425891 | + | 61 | - | - | Antitoxin |
JP49775_RS12215 | 2425908..2426015 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
JP49775_RS12220 | 2426149..2426535 | - | 387 | WP_000779353.1 | flippase GtxA | - |
JP49775_RS12225 | 2426803..2427945 | + | 1143 | WP_029550219.1 | glycerate kinase | - |
JP49775_RS12230 | 2428005..2428664 | + | 660 | WP_000831300.1 | hypothetical protein | - |
JP49775_RS12235 | 2428852..2430063 | + | 1212 | WP_001191974.1 | multidrug effflux MFS transporter | - |
JP49775_RS12240 | 2430186..2430659 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T31433 WP_000482647.1 NZ_AP017922:c2426015-2425908 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T31433 NZ_AP017922:c2426015-2425908 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT31433 NZ_AP017922:2425831-2425891 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|