Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2135693..2135909 | Replicon | chromosome |
Accession | NZ_AP017922 | ||
Organism | Staphylococcus aureus strain JP02758 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | JP49775_RS10710 | Protein ID | WP_001802298.1 |
Coordinates | 2135805..2135909 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2135693..2135748 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JP49775_RS10690 | 2131830..2132495 | - | 666 | WP_001024099.1 | SDR family oxidoreductase | - |
JP49775_RS10695 | 2132647..2132967 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
JP49775_RS10700 | 2132969..2133949 | + | 981 | WP_029550399.1 | CDF family zinc efflux transporter CzrB | - |
JP49775_RS10705 | 2134215..2135306 | + | 1092 | WP_029550400.1 | hypothetical protein | - |
- | 2135693..2135748 | + | 56 | - | - | Antitoxin |
JP49775_RS10710 | 2135805..2135909 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
JP49775_RS10720 | 2136589..2136747 | + | 159 | WP_001792784.1 | hypothetical protein | - |
JP49775_RS10725 | 2137183..2137275 | + | 93 | WP_001794441.1 | hypothetical protein | - |
JP49775_RS10730 | 2137405..2138262 | - | 858 | WP_029550401.1 | Cof-type HAD-IIB family hydrolase | - |
JP49775_RS10735 | 2138330..2139112 | - | 783 | WP_029550402.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T31431 WP_001802298.1 NZ_AP017922:c2135909-2135805 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T31431 NZ_AP017922:c2135909-2135805 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT31431 NZ_AP017922:2135693-2135748 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|