Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
| Location | 2486778..2486962 | Replicon | chromosome |
| Accession | NZ_AP017891 | ||
| Organism | Staphylococcus aureus strain GN3 | ||
Toxin (Protein)
| Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
| Locus tag | CTB89_RS12750 | Protein ID | WP_000482647.1 |
| Coordinates | 2486855..2486962 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2486778..2486838 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CTB89_RS12730 | 2482288..2482455 | - | 168 | WP_001789205.1 | hypothetical protein | - |
| CTB89_RS12740 | 2482686..2484419 | - | 1734 | WP_020977552.1 | ABC transporter ATP-binding protein/permease | - |
| CTB89_RS12745 | 2484444..2486207 | - | 1764 | WP_001064822.1 | ABC transporter ATP-binding protein/permease | - |
| CTB89_RS14415 | 2486661..2486828 | - | 168 | WP_000301893.1 | hypothetical protein | - |
| - | 2486778..2486838 | + | 61 | - | - | Antitoxin |
| CTB89_RS12750 | 2486855..2486962 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| CTB89_RS12755 | 2487096..2487482 | - | 387 | WP_000779353.1 | flippase GtxA | - |
| CTB89_RS12760 | 2487750..2488892 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
| CTB89_RS12765 | 2488952..2489611 | + | 660 | WP_000831298.1 | membrane protein | - |
| CTB89_RS12770 | 2489794..2491005 | + | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
| CTB89_RS12775 | 2491128..2491601 | - | 474 | WP_020977553.1 | GyrI-like domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T31349 WP_000482647.1 NZ_AP017891:c2486962-2486855 [Staphylococcus aureus]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T31349 NZ_AP017891:c2486962-2486855 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT31349 NZ_AP017891:2486778-2486838 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|