Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1970890..1971070 | Replicon | chromosome |
Accession | NZ_AP017891 | ||
Organism | Staphylococcus aureus strain GN3 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | CTB89_RS09800 | Protein ID | WP_001801861.1 |
Coordinates | 1970890..1970985 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1971013..1971070 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CTB89_RS09755 | 1966354..1967352 | + | 999 | WP_120173197.1 | DUF4352 domain-containing protein | - |
CTB89_RS09760 | 1967428..1968054 | + | 627 | WP_000669045.1 | hypothetical protein | - |
CTB89_RS09765 | 1968095..1968436 | + | 342 | WP_000627534.1 | DUF3969 family protein | - |
CTB89_RS09770 | 1968537..1969109 | + | 573 | WP_000414218.1 | hypothetical protein | - |
CTB89_RS09775 | 1969439..1969624 | - | 186 | WP_000809860.1 | hypothetical protein | - |
CTB89_RS09780 | 1969626..1969802 | - | 177 | WP_000375478.1 | hypothetical protein | - |
CTB89_RS09785 | 1969813..1970102 | - | 290 | Protein_1848 | hypothetical protein | - |
CTB89_RS09790 | 1970270..1970503 | - | 234 | Protein_1849 | IS3 family transposase | - |
CTB89_RS09795 | 1970509..1970745 | - | 237 | WP_000251969.1 | IS3 family transposase | - |
CTB89_RS09800 | 1970890..1970985 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1971013..1971070 | - | 58 | - | - | Antitoxin |
CTB89_RS14380 | 1971201..1971356 | + | 156 | WP_001215823.1 | hypothetical protein | - |
CTB89_RS09810 | 1971926..1972368 | - | 443 | Protein_1853 | DUF1433 domain-containing protein | - |
CTB89_RS09815 | 1972368..1972811 | - | 444 | WP_000731420.1 | DUF1433 domain-containing protein | - |
CTB89_RS09820 | 1972811..1973254 | - | 444 | WP_000747798.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1970509..1970745 | 236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T31340 WP_001801861.1 NZ_AP017891:1970890-1970985 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T31340 NZ_AP017891:1970890-1970985 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT31340 NZ_AP017891:c1971070-1971013 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|