Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 318029..318232 | Replicon | chromosome |
Accession | NZ_AP017623 | ||
Organism | Enterococcus faecalis strain W11 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | EFW11_RS01705 | Protein ID | WP_157734666.1 |
Coordinates | 318128..318232 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 318029..318093 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
EFW11_RS01690 | 313647..315389 | + | 1743 | WP_172863357.1 | PTS transporter subunit EIIC | - |
EFW11_RS01695 | 315380..317413 | + | 2034 | WP_002361171.1 | transcription antiterminator | - |
EFW11_RS01700 | 317424..317858 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 318029..318093 | + | 65 | NuclAT_12 | - | Antitoxin |
EFW11_RS01705 | 318128..318232 | - | 105 | WP_157734666.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
EFW11_RS01710 | 318469..320241 | + | 1773 | WP_096397510.1 | PTS mannitol transporter subunit IICBA | - |
EFW11_RS01715 | 320256..320693 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
EFW11_RS01720 | 320708..321862 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
EFW11_RS01725 | 321929..323044 | - | 1116 | WP_010709201.1 | FAD-binding oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 4014.85 Da Isoelectric Point: 6.4459
>T31303 WP_157734666.1 NZ_AP017623:c318232-318128 [Enterococcus faecalis]
VHHIYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
VHHIYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 105 bp
>T31303 NZ_AP017623:c318232-318128 [Enterococcus faecalis]
GTGCATCACATATACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTG
GTTGGAAAAACAGAACGAGGAATAA
GTGCATCACATATACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTG
GTTGGAAAAACAGAACGAGGAATAA
Antitoxin
Download Length: 65 bp
>AT31303 NZ_AP017623:318029-318093 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|