Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 41538..41771 | Replicon | plasmid pMRY15-117_1 |
Accession | NZ_AP017618 | ||
Organism | Escherichia coli strain MRY15-117 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | CPZ03_RS26195 | Protein ID | WP_001312861.1 |
Coordinates | 41538..41696 (-) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 41740..41771 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPZ03_RS26155 | 36585..36812 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
CPZ03_RS26160 | 36906..37592 | - | 687 | WP_000332484.1 | PAS domain-containing protein | - |
CPZ03_RS26165 | 37783..38166 | - | 384 | WP_000124981.1 | relaxosome protein TraM | - |
CPZ03_RS26170 | 38443..39090 | + | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
CPZ03_RS26175 | 39387..40208 | - | 822 | WP_001234469.1 | DUF945 domain-containing protein | - |
CPZ03_RS26180 | 40329..40616 | - | 288 | WP_000107535.1 | hypothetical protein | - |
CPZ03_RS26185 | 40641..40847 | - | 207 | WP_000547939.1 | hypothetical protein | - |
CPZ03_RS26195 | 41538..41696 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 41740..41771 | - | 32 | NuclAT_1 | - | Antitoxin |
- | 41740..41771 | - | 32 | NuclAT_1 | - | Antitoxin |
- | 41740..41771 | - | 32 | NuclAT_1 | - | Antitoxin |
- | 41740..41771 | - | 32 | NuclAT_1 | - | Antitoxin |
- | 43213..43410 | - | 198 | NuclAT_0 | - | - |
- | 43213..43410 | - | 198 | NuclAT_0 | - | - |
- | 43213..43410 | - | 198 | NuclAT_0 | - | - |
- | 43213..43410 | - | 198 | NuclAT_0 | - | - |
CPZ03_RS27670 | 43222..43410 | + | 189 | WP_001299721.1 | hypothetical protein | - |
CPZ03_RS26205 | 43422..44141 | - | 720 | WP_001276228.1 | plasmid SOS inhibition protein A | - |
CPZ03_RS26210 | 44138..44572 | - | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
CPZ03_RS26215 | 44627..46585 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | dfrA14 / mph(A) / sitABCD / erm(B) / aac(3)-IIa / blaCTX-M-27 | - | 1..116529 | 116529 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T31257 WP_001312861.1 NZ_AP017618:c41696-41538 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T31257 NZ_AP017618:c41696-41538 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT31257 NZ_AP017618:c41771-41740 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|