Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 3937525..3937747 | Replicon | chromosome |
Accession | NZ_AP017610 | ||
Organism | Escherichia coli strain 20Ec-P-124 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | CPZ02_RS20365 | Protein ID | WP_001295224.1 |
Coordinates | 3937525..3937632 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 3937689..3937747 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPZ02_RS20340 | 3932778..3933530 | - | 753 | WP_000279544.1 | cellulose biosynthesis protein BcsQ | - |
CPZ02_RS20345 | 3933542..3933730 | - | 189 | WP_001063315.1 | YhjR family protein | - |
CPZ02_RS20350 | 3934003..3935574 | + | 1572 | WP_001204944.1 | cellulose biosynthesis protein BcsE | - |
CPZ02_RS20355 | 3935571..3935762 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
CPZ02_RS20360 | 3935759..3937438 | + | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
CPZ02_RS20365 | 3937525..3937632 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 3937689..3937747 | + | 59 | - | - | Antitoxin |
CPZ02_RS28765 | 3938008..3938115 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
CPZ02_RS20385 | 3938591..3939862 | + | 1272 | WP_001318103.1 | amino acid permease | - |
CPZ02_RS20390 | 3939892..3940896 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
CPZ02_RS20395 | 3940893..3941876 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T31208 WP_001295224.1 NZ_AP017610:c3937632-3937525 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T31208 NZ_AP017610:c3937632-3937525 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT31208 NZ_AP017610:3937689-3937747 [Escherichia coli]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|