Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 474122..474385 | Replicon | chromosome |
Accession | NZ_AP017469 | ||
Organism | Hafnia sp. CBA7124 |
Toxin (Protein)
Gene name | hokH | Uniprot ID | A0A1C6YY26 |
Locus tag | CPY98_RS02165 | Protein ID | WP_025798685.1 |
Coordinates | 474227..474385 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sokH | ||
Locus tag | - | ||
Coordinates | 474122..474174 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
CPY98_RS02145 | 469337..470407 | - | 1071 | WP_043490618.1 | dihydroxyacetone kinase subunit DhaK | - |
CPY98_RS02150 | 470507..471607 | - | 1101 | WP_043490621.1 | glycerol dehydrogenase | - |
CPY98_RS02155 | 472113..472796 | + | 684 | WP_043490623.1 | DUF1190 family protein | - |
CPY98_RS02160 | 472799..473959 | + | 1161 | WP_043490625.1 | glutathionylspermidine synthase family protein | - |
- | 474122..474174 | - | 53 | - | - | Antitoxin |
CPY98_RS02165 | 474227..474385 | + | 159 | WP_025798685.1 | Hok/Gef family protein | Toxin |
CPY98_RS02170 | 474546..476765 | - | 2220 | WP_025798687.1 | lysine decarboxylase | - |
CPY98_RS02175 | 476871..478199 | - | 1329 | WP_025798689.1 | cadaverine/lysine antiporter | - |
CPY98_RS02180 | 478847..479089 | + | 243 | WP_096386189.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6065.37 Da Isoelectric Point: 9.2226
>T31129 WP_025798685.1 NZ_AP017469:474227-474385 [Hafnia sp. CBA7124]
MSRKLLLYGLIVMCFTLLIFTWMVRGSLCELRIKQGKTEVAAFLNYEDKHAL
MSRKLLLYGLIVMCFTLLIFTWMVRGSLCELRIKQGKTEVAAFLNYEDKHAL
Download Length: 159 bp
>T31129 NZ_AP017469:474227-474385 [Hafnia sp. CBA7124]
ATGTCGCGTAAGCTGTTGCTTTACGGATTAATAGTGATGTGTTTTACGCTATTGATCTTTACCTGGATGGTACGTGGTTC
GCTGTGTGAGCTACGAATTAAGCAGGGAAAAACAGAGGTTGCCGCGTTCTTAAACTACGAAGATAAGCACGCGTTGTAA
ATGTCGCGTAAGCTGTTGCTTTACGGATTAATAGTGATGTGTTTTACGCTATTGATCTTTACCTGGATGGTACGTGGTTC
GCTGTGTGAGCTACGAATTAAGCAGGGAAAAACAGAGGTTGCCGCGTTCTTAAACTACGAAGATAAGCACGCGTTGTAA
Antitoxin
Download Length: 53 bp
>AT31129 NZ_AP017469:c474174-474122 [Hafnia sp. CBA7124]
GATGTGGTTAGGATTGCCTCAGGTTAATGAAAATTGACCTGGGGCTTTTACTT
GATGTGGTTAGGATTGCCTCAGGTTAATGAAAATTGACCTGGGGCTTTTACTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|