Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 916955..917137 | Replicon | chromosome |
| Accession | NZ_AP017377 | ||
| Organism | Staphylococcus aureus strain OC8 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | ATE38_RS15230 | Protein ID | WP_001801861.1 |
| Coordinates | 917042..917137 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 916955..917014 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ATE38_RS04630 | 912176..912769 | + | 594 | WP_000035058.1 | peptidylprolyl isomerase | - |
| ATE38_RS04635 | 912976..914148 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| ATE38_RS04640 | 914250..915572 | + | 1323 | Protein_861 | ATP-binding protein | - |
| ATE38_RS04645 | 916093..916470 | + | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
| ATE38_RS04650 | 916664..916840 | + | 177 | Protein_863 | transposase | - |
| ATE38_RS04655 | 916818..916919 | - | 102 | WP_001791893.1 | hypothetical protein | - |
| - | 916955..917014 | + | 60 | - | - | Antitoxin |
| ATE38_RS15230 | 917042..917137 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| ATE38_RS04660 | 917340..917483 | + | 144 | WP_001549059.1 | transposase | - |
| ATE38_RS04670 | 918087..918470 | + | 384 | WP_000070811.1 | hypothetical protein | - |
| ATE38_RS04675 | 918481..918657 | + | 177 | WP_000375476.1 | hypothetical protein | - |
| ATE38_RS04680 | 918659..918844 | + | 186 | WP_000809857.1 | hypothetical protein | - |
| ATE38_RS04685 | 918958..919599 | + | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
| ATE38_RS04690 | 919849..921021 | + | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
| ATE38_RS04695 | 921149..921700 | - | 552 | WP_000414205.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 912976..914148 | 1172 | |
| - | flank | IS/Tn | - | - | 919849..921021 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T31106 WP_001801861.1 NZ_AP017377:c917137-917042 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T31106 NZ_AP017377:c917137-917042 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT31106 NZ_AP017377:916955-917014 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|