Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2259278..2259494 | Replicon | chromosome |
Accession | NZ_AP017320 | ||
Organism | Staphylococcus aureus strain MI |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAMI_RS11565 | Protein ID | WP_001802298.1 |
Coordinates | 2259390..2259494 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF1 | ||
Locus tag | - | ||
Coordinates | 2259278..2259333 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAMI_RS11545 | 2255484..2256149 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
SAMI_RS11550 | 2256301..2256621 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAMI_RS11555 | 2256623..2257600 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
SAMI_RS11560 | 2257866..2258957 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
- | 2259278..2259333 | + | 56 | - | - | Antitoxin |
SAMI_RS11565 | 2259390..2259494 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAMI_RS15435 | 2260174..2260332 | + | 159 | WP_001792784.1 | hypothetical protein | - |
SAMI_RS11570 | 2260990..2261847 | - | 858 | WP_000370923.1 | Cof-type HAD-IIB family hydrolase | - |
SAMI_RS11575 | 2261915..2262697 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T31083 WP_001802298.1 NZ_AP017320:c2259494-2259390 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T31083 NZ_AP017320:c2259494-2259390 [Staphylococcus aureus]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT31083 NZ_AP017320:2259278-2259333 [Staphylococcus aureus]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|