Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2086848..2087147 | Replicon | chromosome |
Accession | NZ_AP017320 | ||
Organism | Staphylococcus aureus strain MI |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | SAMI_RS15375 | Protein ID | WP_011447039.1 |
Coordinates | 2086971..2087147 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2086848..2086903 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAMI_RS10580 | 2082180..2082440 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SAMI_RS10585 | 2082493..2082843 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
SAMI_RS10590 | 2083527..2083976 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
SAMI_RS15700 | 2084071..2084406 | - | 336 | Protein_2004 | SH3 domain-containing protein | - |
SAMI_RS10600 | 2085056..2085547 | - | 492 | WP_000919350.1 | staphylokinase | - |
SAMI_RS10605 | 2085738..2086493 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAMI_RS10610 | 2086505..2086759 | - | 255 | WP_000611512.1 | phage holin | - |
SAMI_RS10615 | 2086811..2086918 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2086840..2086979 | + | 140 | NuclAT_0 | - | - |
- | 2086840..2086979 | + | 140 | NuclAT_0 | - | - |
- | 2086840..2086979 | + | 140 | NuclAT_0 | - | - |
- | 2086840..2086979 | + | 140 | NuclAT_0 | - | - |
- | 2086848..2086903 | + | 56 | - | - | Antitoxin |
SAMI_RS15375 | 2086971..2087147 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
SAMI_RS10620 | 2087297..2087593 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
SAMI_RS10625 | 2087651..2087938 | - | 288 | WP_001040254.1 | hypothetical protein | - |
SAMI_RS10630 | 2087985..2088137 | - | 153 | WP_001153681.1 | hypothetical protein | - |
SAMI_RS10635 | 2088127..2091912 | - | 3786 | WP_000582180.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2082493..2136787 | 54294 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T31079 WP_011447039.1 NZ_AP017320:c2087147-2086971 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T31079 NZ_AP017320:c2087147-2086971 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT31079 NZ_AP017320:2086848-2086903 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|