Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1932589..1932769 | Replicon | chromosome |
Accession | NZ_AP017320 | ||
Organism | Staphylococcus aureus strain MI |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAMI_RS15680 | Protein ID | WP_001801861.1 |
Coordinates | 1932589..1932684 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1932712..1932769 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAMI_RS09590 | 1927752..1928402 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
SAMI_RS09595 | 1928483..1929478 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
SAMI_RS09600 | 1929553..1930179 | + | 627 | WP_000669024.1 | hypothetical protein | - |
SAMI_RS09605 | 1930220..1930561 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
SAMI_RS09610 | 1930662..1931234 | + | 573 | WP_000414216.1 | hypothetical protein | - |
SAMI_RS15320 | 1931432..1932444 | - | 1013 | Protein_1850 | IS3 family transposase | - |
SAMI_RS15680 | 1932589..1932684 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1932712..1932769 | - | 58 | - | - | Antitoxin |
SAMI_RS09630 | 1932807..1932908 | + | 102 | WP_001792025.1 | hypothetical protein | - |
SAMI_RS15685 | 1932886..1933047 | - | 162 | Protein_1853 | transposase | - |
SAMI_RS09635 | 1933038..1933532 | - | 495 | Protein_1854 | transposase | - |
SAMI_RS09640 | 1933984..1935213 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
SAMI_RS09645 | 1935206..1936762 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
SAMI_RS09650 | 1936912..1937046 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1926994..1992166 | 65172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T31075 WP_001801861.1 NZ_AP017320:1932589-1932684 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T31075 NZ_AP017320:1932589-1932684 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT31075 NZ_AP017320:c1932769-1932712 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|