Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2002504..2002803 | Replicon | chromosome |
Accession | NZ_AP014942 | ||
Organism | Staphylococcus aureus strain FDA209P |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | SAFDA_RS14645 | Protein ID | WP_072353918.1 |
Coordinates | 2002627..2002803 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2002504..2002559 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAFDA_RS09955 | 1998062..1998241 | + | 180 | WP_000669789.1 | hypothetical protein | - |
SAFDA_RS09965 | 1998552..1998812 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SAFDA_RS09970 | 1998865..1999215 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
SAFDA_RS14975 | 1999725..2000060 | - | 336 | Protein_1877 | SH3 domain-containing protein | - |
SAFDA_RS09980 | 2000712..2001203 | - | 492 | WP_000920041.1 | staphylokinase | - |
SAFDA_RS09985 | 2001394..2002149 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAFDA_RS09990 | 2002161..2002415 | - | 255 | WP_000611512.1 | phage holin | - |
SAFDA_RS09995 | 2002467..2002574 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2002496..2002635 | + | 140 | NuclAT_0 | - | - |
- | 2002496..2002635 | + | 140 | NuclAT_0 | - | - |
- | 2002496..2002635 | + | 140 | NuclAT_0 | - | - |
- | 2002496..2002635 | + | 140 | NuclAT_0 | - | - |
- | 2002504..2002559 | + | 56 | - | - | Antitoxin |
SAFDA_RS14645 | 2002627..2002803 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
SAFDA_RS10000 | 2002946..2003320 | - | 375 | WP_000340977.1 | hypothetical protein | - |
SAFDA_RS10005 | 2003376..2003663 | - | 288 | WP_001262620.1 | hypothetical protein | - |
SAFDA_RS10010 | 2003709..2003861 | - | 153 | WP_001000058.1 | hypothetical protein | - |
SAFDA_RS10015 | 2003854..2007636 | - | 3783 | WP_042727565.1 | phage minor structural protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 1998865..2056496 | 57631 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T31020 WP_072353918.1 NZ_AP014942:c2002803-2002627 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T31020 NZ_AP014942:c2002803-2002627 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT31020 NZ_AP014942:2002504-2002559 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|