Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1860027..1860209 | Replicon | chromosome |
Accession | NZ_AP014921 | ||
Organism | Staphylococcus aureus strain JH4899 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | JSA_RS14840 | Protein ID | WP_001801861.1 |
Coordinates | 1860027..1860122 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1860150..1860209 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JSA_RS09275 | 1855687..1856313 | + | 627 | WP_000669046.1 | hypothetical protein | - |
JSA_RS09280 | 1856354..1856698 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
JSA_RS09285 | 1856796..1857347 | + | 552 | WP_096391891.1 | hypothetical protein | - |
JSA_RS09290 | 1857565..1858206 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
JSA_RS09295 | 1858320..1858505 | - | 186 | WP_000809857.1 | hypothetical protein | - |
JSA_RS09300 | 1858507..1858683 | - | 177 | WP_000375476.1 | hypothetical protein | - |
JSA_RS09305 | 1858694..1859077 | - | 384 | WP_000070811.1 | hypothetical protein | - |
JSA_RS09315 | 1859681..1859824 | - | 144 | WP_001549059.1 | transposase | - |
JSA_RS14840 | 1860027..1860122 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1860150..1860209 | - | 60 | - | - | Antitoxin |
JSA_RS09320 | 1860245..1860346 | + | 102 | WP_001791893.1 | hypothetical protein | - |
JSA_RS09325 | 1860324..1860500 | - | 177 | Protein_1758 | transposase | - |
JSA_RS09330 | 1860694..1861071 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 1853127..1876981 | 23854 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T31001 WP_001801861.1 NZ_AP014921:1860027-1860122 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T31001 NZ_AP014921:1860027-1860122 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 60 bp
>AT31001 NZ_AP014921:c1860209-1860150 [Staphylococcus aureus]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|