Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2456481..2456665 | Replicon | chromosome |
Accession | NZ_AP014653 | ||
Organism | Staphylococcus aureus strain TMUS2134 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | SAJPND4_RS12430 | Protein ID | WP_000482650.1 |
Coordinates | 2456558..2456665 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2456481..2456541 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAJPND4_RS12405 | 2451991..2452158 | - | 168 | WP_001792506.1 | hypothetical protein | - |
SAJPND4_RS12415 | 2452389..2454122 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
SAJPND4_RS12420 | 2454147..2455910 | - | 1764 | WP_001064820.1 | ABC transporter ATP-binding protein/permease | - |
- | 2456481..2456541 | + | 61 | - | - | Antitoxin |
SAJPND4_RS12430 | 2456558..2456665 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAJPND4_RS12435 | 2456799..2457185 | - | 387 | WP_000779358.1 | flippase GtxA | - |
SAJPND4_RS12440 | 2457443..2458585 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SAJPND4_RS12445 | 2458645..2459304 | + | 660 | WP_000831298.1 | membrane protein | - |
SAJPND4_RS12450 | 2459486..2460697 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SAJPND4_RS12455 | 2460820..2461293 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T30866 WP_000482650.1 NZ_AP014653:c2456665-2456558 [Staphylococcus aureus]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T30866 NZ_AP014653:c2456665-2456558 [Staphylococcus aureus]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT30866 NZ_AP014653:2456481-2456541 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|