Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF4/- |
Location | 1999469..1999768 | Replicon | chromosome |
Accession | NZ_AP014653 | ||
Organism | Staphylococcus aureus strain TMUS2134 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | SAJPND4_RS14445 | Protein ID | WP_011447039.1 |
Coordinates | 1999592..1999768 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 1999469..1999524 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAJPND4_RS09940 | 1994812..1995072 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SAJPND4_RS09945 | 1995125..1995465 | - | 341 | Protein_1872 | complement inhibitor SCIN-A | - |
SAJPND4_RS09950 | 1996148..1996597 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
SAJPND4_RS14790 | 1996692..1997027 | - | 336 | Protein_1874 | SH3 domain-containing protein | - |
SAJPND4_RS09960 | 1997677..1998168 | - | 492 | WP_000919350.1 | staphylokinase | - |
SAJPND4_RS09965 | 1998359..1999114 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAJPND4_RS09970 | 1999126..1999380 | - | 255 | WP_000611512.1 | phage holin | - |
SAJPND4_RS09975 | 1999432..1999539 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1999461..1999600 | + | 140 | NuclAT_0 | - | - |
- | 1999461..1999600 | + | 140 | NuclAT_0 | - | - |
- | 1999461..1999600 | + | 140 | NuclAT_0 | - | - |
- | 1999461..1999600 | + | 140 | NuclAT_0 | - | - |
- | 1999469..1999524 | + | 56 | - | - | Antitoxin |
SAJPND4_RS14445 | 1999592..1999768 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
SAJPND4_RS09980 | 1999918..2000214 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
SAJPND4_RS09985 | 2000272..2000559 | - | 288 | WP_001040261.1 | hypothetical protein | - |
SAJPND4_RS09990 | 2000606..2000758 | - | 153 | WP_001153681.1 | hypothetical protein | - |
SAJPND4_RS09995 | 2000748..2004533 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / scn / chp / sak / hlb / groEL | 1995125..2047458 | 52333 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T30859 WP_011447039.1 NZ_AP014653:c1999768-1999592 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T30859 NZ_AP014653:c1999768-1999592 [Staphylococcus aureus]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT30859 NZ_AP014653:1999469-1999524 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|