Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1832499..1832679 | Replicon | chromosome |
Accession | NZ_AP014653 | ||
Organism | Staphylococcus aureus strain TMUS2134 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAJPND4_RS14765 | Protein ID | WP_001801861.1 |
Coordinates | 1832499..1832594 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1832622..1832679 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAJPND4_RS08885 | 1827541..1828167 | + | 627 | WP_000669021.1 | hypothetical protein | - |
SAJPND4_RS08890 | 1828208..1828549 | + | 342 | WP_000627547.1 | DUF3969 family protein | - |
SAJPND4_RS08895 | 1828650..1829221 | + | 572 | Protein_1705 | hypothetical protein | - |
SAJPND4_RS08900 | 1829419..1829976 | - | 558 | WP_000864139.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAJPND4_RS08910 | 1830347..1830523 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SAJPND4_RS08915 | 1830534..1830917 | - | 384 | WP_000070811.1 | hypothetical protein | - |
SAJPND4_RS08920 | 1831602..1832048 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
SAJPND4_RS14765 | 1832499..1832594 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1832622..1832679 | - | 58 | - | - | Antitoxin |
SAJPND4_RS08930 | 1832717..1832818 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SAJPND4_RS14395 | 1832796..1832978 | - | 183 | Protein_1712 | transposase | - |
SAJPND4_RS08935 | 1833166..1833540 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
SAJPND4_RS08940 | 1833562..1833909 | - | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
SAJPND4_RS08945 | 1834146..1834562 | - | 417 | WP_020978241.1 | DUF1433 domain-containing protein | - |
SAJPND4_RS08950 | 1835209..1836327 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1824983..1862494 | 37511 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T30855 WP_001801861.1 NZ_AP014653:1832499-1832594 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T30855 NZ_AP014653:1832499-1832594 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT30855 NZ_AP014653:c1832679-1832622 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|