Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 43331..43595 | Replicon | plasmid pHUSEC2011-1 |
Accession | NC_022742 | ||
Organism | Escherichia coli |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Z417 |
Locus tag | HUS2011_RS27715 | Protein ID | WP_001387489.1 |
Coordinates | 43443..43595 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 43331..43393 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HUS2011_RS27700 | 39433..40503 | - | 1071 | WP_000151588.1 | IncI1-type conjugal transfer protein TrbB | - |
HUS2011_RS27705 | 40522..41730 | - | 1209 | WP_000121263.1 | IncI1-type conjugal transfer protein TrbA | - |
HUS2011_RS27710 | 42037..43128 | - | 1092 | WP_000426061.1 | hypothetical protein | - |
- | 43331..43393 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 43331..43393 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 43331..43393 | - | 63 | NuclAT_0 | - | Antitoxin |
- | 43331..43393 | - | 63 | NuclAT_0 | - | Antitoxin |
HUS2011_RS27715 | 43443..43595 | + | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
HUS2011_RS27720 | 43667..43918 | - | 252 | WP_001291964.1 | hypothetical protein | - |
HUS2011_RS27725 | 44218..44514 | + | 297 | WP_001275298.1 | hypothetical protein | - |
HUS2011_RS31775 | 44579..44755 | - | 177 | WP_001054898.1 | hypothetical protein | - |
HUS2011_RS27740 | 44938..45147 | - | 210 | WP_001140543.1 | hemolysin expression modulator Hha | - |
HUS2011_RS27745 | 45245..45859 | - | 615 | WP_000578648.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
HUS2011_RS27750 | 45935..48103 | - | 2169 | WP_000698360.1 | IncI1-type conjugal transfer membrane protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaCTX-M-15 / blaTEM-1B | - | 1..88546 | 88546 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T30309 WP_001387489.1 NC_022742:43443-43595 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T30309 NC_022742:43443-43595 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 63 bp
>AT30309 NC_022742:c43393-43331 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|