Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-sprA1AS/- |
Location | 416362..416523 | Replicon | chromosome |
Accession | NC_022737 | ||
Organism | Staphylococcus pasteuri SP1 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | - |
Locus tag | STP1_RS12745 | Protein ID | WP_015364873.1 |
Coordinates | 416428..416523 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 416362..416396 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
STP1_RS01825 | 411398..412621 | - | 1224 | WP_023373041.1 | ABC transporter permease | - |
STP1_RS01830 | 412614..413354 | - | 741 | WP_023373042.1 | ABC transporter ATP-binding protein | - |
STP1_RS01835 | 413486..413911 | + | 426 | WP_023373044.1 | HIT family protein | - |
STP1_RS01840 | 413989..414360 | + | 372 | WP_002452114.1 | YtxH domain-containing protein | - |
STP1_RS01845 | 414549..415106 | + | 558 | WP_023373046.1 | DUF3267 domain-containing protein | - |
STP1_RS01850 | 415284..416276 | + | 993 | WP_002466825.1 | peptidylprolyl isomerase | - |
- | 416362..416396 | + | 35 | - | - | Antitoxin |
STP1_RS12745 | 416428..416523 | - | 96 | WP_015364873.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
STP1_RS01855 | 417108..418049 | - | 942 | WP_023373048.1 | 3'-5' exoribonuclease YhaM | - |
STP1_RS01860 | 418049..420982 | - | 2934 | WP_023373050.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3610.26 Da Isoelectric Point: 8.0878
>T30299 WP_015364873.1 NC_022737:c416523-416428 [Staphylococcus pasteuri SP1]
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
MTEIFVHIATTVISGCIVTLFAHWLRHRNDK
Download Length: 96 bp
>T30299 NC_022737:c416523-416428 [Staphylococcus pasteuri SP1]
ATGACTGAAATCTTTGTTCATATCGCAACTACTGTTATAAGTGGTTGTATCGTTACATTATTTGCGCATTGGCTACGCCA
TCGTAACGACAAGTAA
ATGACTGAAATCTTTGTTCATATCGCAACTACTGTTATAAGTGGTTGTATCGTTACATTATTTGCGCATTGGCTACGCCA
TCGTAACGACAAGTAA
Antitoxin
Download Length: 35 bp
>AT30299 NC_022737:416362-416396 [Staphylococcus pasteuri SP1]
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
ACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|