Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 24523..24792 | Replicon | plasmid pJJ1886_5 |
Accession | NC_022651 | ||
Organism | Escherichia coli JJ1886 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | P423_RS26465 | Protein ID | WP_001312861.1 |
Coordinates | 24634..24792 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 24523..24588 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P423_RS26435 | 20316..20843 | + | 528 | WP_000290793.1 | single-stranded DNA-binding protein | - |
P423_RS26440 | 20899..21132 | + | 234 | WP_000006004.1 | DUF905 domain-containing protein | - |
P423_RS26445 | 21191..23149 | + | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
P423_RS26450 | 23204..23638 | + | 435 | WP_000845901.1 | conjugation system SOS inhibitor PsiB | - |
P423_RS26455 | 23635..24354 | + | 720 | WP_001276234.1 | plasmid SOS inhibition protein A | - |
P423_RS30375 | 24366..24554 | - | 189 | WP_001299721.1 | hypothetical protein | - |
- | 24366..24590 | + | 225 | NuclAT_0 | - | - |
- | 24366..24590 | + | 225 | NuclAT_0 | - | - |
- | 24366..24590 | + | 225 | NuclAT_0 | - | - |
- | 24366..24590 | + | 225 | NuclAT_0 | - | - |
- | 24523..24588 | + | 66 | - | - | Antitoxin |
P423_RS26465 | 24634..24792 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
P423_RS26470 | 25143..25847 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
P423_RS26475 | 25900..27795 | + | 1896 | Protein_31 | Tn3 family transposase | - |
P423_RS26480 | 27894..28547 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
P423_RS30290 | 28640..28897 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
P423_RS26490 | 28830..29231 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaOXA-1 / aac(6')-Ib-cr / blaTEM-1B | - | 1..110040 | 110040 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T30266 WP_001312861.1 NC_022651:24634-24792 [Escherichia coli JJ1886]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T30266 NC_022651:24634-24792 [Escherichia coli JJ1886]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 66 bp
>AT30266 NC_022651:24523-24588 [Escherichia coli JJ1886]
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
AGAAGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCAC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|