Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1387428..1387649 Replicon chromosome
Accession NC_022648
Organism Escherichia coli JJ1886

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag P423_RS07055 Protein ID WP_001531632.1
Coordinates 1387428..1387535 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1387583..1387649 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
P423_RS07030 1383272..1384354 + 1083 WP_000804726.1 peptide chain release factor 1 -
P423_RS07035 1384354..1385187 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
P423_RS07040 1385184..1385576 + 393 WP_000200375.1 invasion regulator SirB2 -
P423_RS07045 1385580..1386389 + 810 WP_001257044.1 invasion regulator SirB1 -
P423_RS07050 1386425..1387279 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
P423_RS07055 1387428..1387535 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1387583..1387649 + 67 NuclAT_10 - Antitoxin
- 1387583..1387649 + 67 NuclAT_10 - Antitoxin
- 1387583..1387649 + 67 NuclAT_10 - Antitoxin
- 1387583..1387649 + 67 NuclAT_10 - Antitoxin
- 1387583..1387649 + 67 NuclAT_5 - Antitoxin
- 1387583..1387649 + 67 NuclAT_5 - Antitoxin
- 1387583..1387649 + 67 NuclAT_5 - Antitoxin
- 1387583..1387649 + 67 NuclAT_5 - Antitoxin
- 1387583..1387649 + 67 NuclAT_6 - Antitoxin
- 1387583..1387649 + 67 NuclAT_6 - Antitoxin
- 1387583..1387649 + 67 NuclAT_6 - Antitoxin
- 1387583..1387649 + 67 NuclAT_6 - Antitoxin
- 1387583..1387649 + 67 NuclAT_7 - Antitoxin
- 1387583..1387649 + 67 NuclAT_7 - Antitoxin
- 1387583..1387649 + 67 NuclAT_7 - Antitoxin
- 1387583..1387649 + 67 NuclAT_7 - Antitoxin
- 1387583..1387649 + 67 NuclAT_8 - Antitoxin
- 1387583..1387649 + 67 NuclAT_8 - Antitoxin
- 1387583..1387649 + 67 NuclAT_8 - Antitoxin
- 1387583..1387649 + 67 NuclAT_8 - Antitoxin
- 1387583..1387649 + 67 NuclAT_9 - Antitoxin
- 1387583..1387649 + 67 NuclAT_9 - Antitoxin
- 1387583..1387649 + 67 NuclAT_9 - Antitoxin
- 1387583..1387649 + 67 NuclAT_9 - Antitoxin
- 1387585..1387648 + 64 NuclAT_12 - -
- 1387585..1387648 + 64 NuclAT_12 - -
- 1387585..1387648 + 64 NuclAT_12 - -
- 1387585..1387648 + 64 NuclAT_12 - -
- 1387585..1387648 + 64 NuclAT_13 - -
- 1387585..1387648 + 64 NuclAT_13 - -
- 1387585..1387648 + 64 NuclAT_13 - -
- 1387585..1387648 + 64 NuclAT_13 - -
- 1387585..1387648 + 64 NuclAT_14 - -
- 1387585..1387648 + 64 NuclAT_14 - -
- 1387585..1387648 + 64 NuclAT_14 - -
- 1387585..1387648 + 64 NuclAT_14 - -
- 1387585..1387648 + 64 NuclAT_15 - -
- 1387585..1387648 + 64 NuclAT_15 - -
- 1387585..1387648 + 64 NuclAT_15 - -
- 1387585..1387648 + 64 NuclAT_15 - -
- 1387585..1387648 + 64 NuclAT_16 - -
- 1387585..1387648 + 64 NuclAT_16 - -
- 1387585..1387648 + 64 NuclAT_16 - -
- 1387585..1387648 + 64 NuclAT_16 - -
- 1387585..1387648 + 64 NuclAT_17 - -
- 1387585..1387648 + 64 NuclAT_17 - -
- 1387585..1387648 + 64 NuclAT_17 - -
- 1387585..1387648 + 64 NuclAT_17 - -
- 1387585..1387650 + 66 NuclAT_18 - -
- 1387585..1387650 + 66 NuclAT_18 - -
- 1387585..1387650 + 66 NuclAT_18 - -
- 1387585..1387650 + 66 NuclAT_18 - -
- 1387585..1387650 + 66 NuclAT_19 - -
- 1387585..1387650 + 66 NuclAT_19 - -
- 1387585..1387650 + 66 NuclAT_19 - -
- 1387585..1387650 + 66 NuclAT_19 - -
- 1387585..1387650 + 66 NuclAT_20 - -
- 1387585..1387650 + 66 NuclAT_20 - -
- 1387585..1387650 + 66 NuclAT_20 - -
- 1387585..1387650 + 66 NuclAT_20 - -
- 1387585..1387650 + 66 NuclAT_21 - -
- 1387585..1387650 + 66 NuclAT_21 - -
- 1387585..1387650 + 66 NuclAT_21 - -
- 1387585..1387650 + 66 NuclAT_21 - -
- 1387585..1387650 + 66 NuclAT_22 - -
- 1387585..1387650 + 66 NuclAT_22 - -
- 1387585..1387650 + 66 NuclAT_22 - -
- 1387585..1387650 + 66 NuclAT_22 - -
- 1387585..1387650 + 66 NuclAT_23 - -
- 1387585..1387650 + 66 NuclAT_23 - -
- 1387585..1387650 + 66 NuclAT_23 - -
- 1387585..1387650 + 66 NuclAT_23 - -
P423_RS07060 1387940..1389040 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
P423_RS07065 1389310..1389549 + 240 WP_000120702.1 putative cation transport regulator ChaB -
P423_RS07070 1389698..1390393 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
P423_RS07075 1390437..1390790 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
P423_RS07080 1390975..1392369 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T30236 WP_001531632.1 NC_022648:c1387535-1387428 [Escherichia coli JJ1886]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T30236 NC_022648:c1387535-1387428 [Escherichia coli JJ1886]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACAACCTGGCGGCACCGATCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT30236 NC_022648:1387583-1387649 [Escherichia coli JJ1886]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References