Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 2361277..2361494 | Replicon | chromosome |
Accession | NC_022604 | ||
Organism | Staphylococcus aureus subsp. aureus Z172 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | SAZ172_RS12255 | Protein ID | WP_001802298.1 |
Coordinates | 2361390..2361494 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 2361277..2361332 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAZ172_RS12235 | 2357414..2358079 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
SAZ172_RS12240 | 2358231..2358551 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
SAZ172_RS12245 | 2358553..2359533 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
SAZ172_RS12250 | 2359799..2360890 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
- | 2361277..2361332 | + | 56 | - | - | Antitoxin |
SAZ172_RS12255 | 2361390..2361494 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
SAZ172_RS16610 | 2361655..2362138 | - | 484 | Protein_2334 | recombinase family protein | - |
SAZ172_RS12265 | 2362181..2363317 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
SAZ172_RS12270 | 2363606..2363698 | + | 93 | WP_001790138.1 | hypothetical protein | - |
SAZ172_RS12275 | 2364404..2365261 | - | 858 | WP_000370924.1 | Cof-type HAD-IIB family hydrolase | - |
SAZ172_RS12280 | 2365329..2366111 | - | 783 | WP_000908176.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T30227 WP_001802298.1 NC_022604:c2361494-2361390 [Staphylococcus aureus subsp. aureus Z172]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T30227 NC_022604:c2361494-2361390 [Staphylococcus aureus subsp. aureus Z172]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT30227 NC_022604:2361277-2361332 [Staphylococcus aureus subsp. aureus Z172]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|