Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2112718..2113017 | Replicon | chromosome |
| Accession | NC_022604 | ||
| Organism | Staphylococcus aureus subsp. aureus Z172 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
| Locus tag | SAZ172_RS16195 | Protein ID | WP_072482930.1 |
| Coordinates | 2112841..2113017 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2112718..2112773 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAZ172_RS10645 | 2108277..2108456 | + | 180 | WP_000669789.1 | hypothetical protein | - |
| SAZ172_RS10655 | 2108767..2109027 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| SAZ172_RS10660 | 2109080..2109430 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
| SAZ172_RS16580 | 2109939..2110274 | - | 336 | Protein_2024 | SH3 domain-containing protein | - |
| SAZ172_RS10670 | 2110926..2111417 | - | 492 | WP_000920041.1 | staphylokinase | - |
| SAZ172_RS10675 | 2111608..2112363 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| SAZ172_RS10680 | 2112375..2112629 | - | 255 | WP_000611512.1 | phage holin | - |
| SAZ172_RS10685 | 2112681..2112788 | + | 108 | Protein_2028 | hypothetical protein | - |
| - | 2112710..2112849 | + | 140 | NuclAT_0 | - | - |
| - | 2112710..2112849 | + | 140 | NuclAT_0 | - | - |
| - | 2112710..2112849 | + | 140 | NuclAT_0 | - | - |
| - | 2112710..2112849 | + | 140 | NuclAT_0 | - | - |
| - | 2112718..2112773 | + | 56 | - | - | Antitoxin |
| SAZ172_RS16195 | 2112841..2113017 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
| SAZ172_RS10695 | 2113126..2113899 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
| SAZ172_RS10700 | 2114272..2114646 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| SAZ172_RS10705 | 2114702..2114989 | - | 288 | WP_001262621.1 | hypothetical protein | - |
| SAZ172_RS10710 | 2115035..2115187 | - | 153 | WP_001000059.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2109080..2166604 | 57524 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T30217 WP_072482930.1 NC_022604:c2113017-2112841 [Staphylococcus aureus subsp. aureus Z172]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T30217 NC_022604:c2113017-2112841 [Staphylococcus aureus subsp. aureus Z172]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT30217 NC_022604:2112718-2112773 [Staphylococcus aureus subsp. aureus Z172]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|