Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1954026..1954205 | Replicon | chromosome |
Accession | NC_022604 | ||
Organism | Staphylococcus aureus subsp. aureus Z172 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAZ172_RS16565 | Protein ID | WP_144316852.1 |
Coordinates | 1954026..1954121 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1954147..1954205 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAZ172_RS09660 | 1949685..1950311 | + | 627 | WP_000669046.1 | hypothetical protein | - |
SAZ172_RS09665 | 1950352..1950696 | + | 345 | WP_000627551.1 | DUF3969 family protein | - |
SAZ172_RS09670 | 1950794..1951345 | + | 552 | WP_000414205.1 | hypothetical protein | - |
SAZ172_RS09675 | 1951563..1952204 | - | 642 | WP_000494956.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAZ172_RS09680 | 1952318..1952503 | - | 186 | WP_000809857.1 | hypothetical protein | - |
SAZ172_RS09685 | 1952505..1952681 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SAZ172_RS09690 | 1952692..1953075 | - | 384 | WP_000070811.1 | hypothetical protein | - |
SAZ172_RS09700 | 1953679..1953822 | - | 144 | WP_001549059.1 | transposase | - |
SAZ172_RS16565 | 1954026..1954121 | + | 96 | WP_144316852.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 1954147..1954205 | - | 59 | - | - | Antitoxin |
SAZ172_RS09705 | 1954241..1954342 | + | 102 | WP_001791893.1 | hypothetical protein | - |
SAZ172_RS16115 | 1954320..1954496 | - | 177 | Protein_1874 | transposase | - |
SAZ172_RS09710 | 1954690..1955067 | - | 378 | WP_001037045.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA | 1928000..1985629 | 57629 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3572.24 Da Isoelectric Point: 9.2774
>T30214 WP_144316852.1 NC_022604:1954026-1954121 [Staphylococcus aureus subsp. aureus Z172]
MLEILVHITTTVISGCAIAFFSYWLSRRNTK
MLEILVHITTTVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T30214 NC_022604:1954026-1954121 [Staphylococcus aureus subsp. aureus Z172]
ATGCTAGAAATTCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
ATGCTAGAAATTCTTGTTCACATCACGACCACAGTCATCAGTGGTTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 59 bp
>AT30214 NC_022604:c1954205-1954147 [Staphylococcus aureus subsp. aureus Z172]
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTGCCGTAGTGAGGGG
ACAACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTGCCGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|