Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2395149..2395333 | Replicon | chromosome |
Accession | NC_022443 | ||
Organism | Staphylococcus aureus subsp. aureus SA40 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SA40_RS11960 | Protein ID | WP_000482647.1 |
Coordinates | 2395226..2395333 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2395149..2395209 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SA40_RS11940 | 2390659..2390826 | - | 168 | WP_031845053.1 | hypothetical protein | - |
SA40_RS11950 | 2391057..2392790 | - | 1734 | WP_000488493.1 | ABC transporter ATP-binding protein/permease | - |
SA40_RS11955 | 2392866..2394578 | - | 1713 | WP_001064821.1 | ABC transporter ATP-binding protein/permease | - |
- | 2395149..2395209 | + | 61 | - | - | Antitoxin |
SA40_RS11960 | 2395226..2395333 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SA40_RS11965 | 2395466..2395852 | - | 387 | WP_000779353.1 | flippase GtxA | - |
SA40_RS11970 | 2396120..2397262 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SA40_RS11975 | 2397322..2397981 | + | 660 | WP_000831298.1 | membrane protein | - |
SA40_RS11980 | 2398164..2399375 | + | 1212 | WP_001191921.1 | multidrug effflux MFS transporter | - |
SA40_RS11985 | 2399498..2399971 | - | 474 | WP_000456483.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T30134 WP_000482647.1 NC_022443:c2395333-2395226 [Staphylococcus aureus subsp. aureus SA40]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T30134 NC_022443:c2395333-2395226 [Staphylococcus aureus subsp. aureus SA40]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT30134 NC_022443:2395149-2395209 [Staphylococcus aureus subsp. aureus SA40]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|