Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | SprG3-SprA2AS/- |
| Location | 2108377..2108575 | Replicon | chromosome |
| Accession | NC_022443 | ||
| Organism | Staphylococcus aureus subsp. aureus SA40 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | SA40_RS10450 | Protein ID | WP_001802298.1 |
| Coordinates | 2108471..2108575 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprA2AS | ||
| Locus tag | - | ||
| Coordinates | 2108377..2108415 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SA40_RS10430 | 2104549..2105214 | - | 666 | WP_001024088.1 | SDR family oxidoreductase | - |
| SA40_RS10435 | 2105366..2105686 | + | 321 | WP_000139802.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| SA40_RS10440 | 2105688..2106665 | + | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
| SA40_RS10445 | 2106931..2108022 | + | 1092 | WP_000495695.1 | hypothetical protein | - |
| - | 2108377..2108415 | + | 39 | - | - | Antitoxin |
| SA40_RS10450 | 2108471..2108575 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| SA40_RS14490 | 2108736..2109219 | - | 484 | Protein_1966 | recombinase family protein | - |
| SA40_RS14185 | 2109262..2110398 | - | 1137 | Protein_1967 | SAP domain-containing protein | - |
| SA40_RS10470 | 2110687..2110779 | + | 93 | WP_031844941.1 | hypothetical protein | - |
| SA40_RS10475 | 2111474..2112331 | - | 858 | WP_000370919.1 | Cof-type HAD-IIB family hydrolase | - |
| SA40_RS10480 | 2112399..2113181 | - | 783 | WP_000908190.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T30132 WP_001802298.1 NC_022443:c2108575-2108471 [Staphylococcus aureus subsp. aureus SA40]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T30132 NC_022443:c2108575-2108471 [Staphylococcus aureus subsp. aureus SA40]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 39 bp
>AT30132 NC_022443:2108377-2108415 [Staphylococcus aureus subsp. aureus SA40]
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
AACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGAC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|