Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2435471..2435655 | Replicon | chromosome |
Accession | NC_022226 | ||
Organism | Staphylococcus aureus subsp. aureus CN1 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | Q2FVI9 |
Locus tag | SAKOR_RS12380 | Protein ID | WP_000482650.1 |
Coordinates | 2435548..2435655 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2435471..2435531 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAKOR_RS12355 | 2430981..2431148 | - | 168 | WP_001792506.1 | hypothetical protein | - |
SAKOR_RS12365 | 2431379..2433112 | - | 1734 | WP_000486494.1 | ABC transporter ATP-binding protein/permease | - |
SAKOR_RS12370 | 2433137..2434900 | - | 1764 | WP_001064820.1 | ABC transporter ATP-binding protein/permease | - |
- | 2435471..2435531 | + | 61 | - | - | Antitoxin |
SAKOR_RS12380 | 2435548..2435655 | - | 108 | WP_000482650.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SAKOR_RS12385 | 2435789..2436175 | - | 387 | WP_000779358.1 | flippase GtxA | - |
SAKOR_RS12390 | 2436433..2437575 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
SAKOR_RS12395 | 2437635..2438294 | + | 660 | WP_000831298.1 | membrane protein | - |
SAKOR_RS12400 | 2438476..2439687 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
SAKOR_RS12405 | 2439810..2440283 | - | 474 | WP_000456489.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T29981 WP_000482650.1 NC_022226:c2435655-2435548 [Staphylococcus aureus subsp. aureus CN1]
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSAISGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T29981 NC_022226:c2435655-2435548 [Staphylococcus aureus subsp. aureus CN1]
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTAACATCATGACTTCAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT29981 NC_022226:2435471-2435531 [Staphylococcus aureus subsp. aureus CN1]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|