Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF4/- |
Location | 1981064..1981363 | Replicon | chromosome |
Accession | NC_022226 | ||
Organism | Staphylococcus aureus subsp. aureus CN1 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | Q2FWU9 |
Locus tag | SAKOR_RS14440 | Protein ID | WP_011447039.1 |
Coordinates | 1981187..1981363 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF4 | ||
Locus tag | - | ||
Coordinates | 1981064..1981119 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAKOR_RS09875 | 1976406..1976666 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SAKOR_RS09880 | 1976719..1977059 | - | 341 | Protein_1858 | complement inhibitor SCIN-A | - |
SAKOR_RS09885 | 1977743..1978192 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
SAKOR_RS14810 | 1978287..1978622 | - | 336 | Protein_1860 | SH3 domain-containing protein | - |
SAKOR_RS09895 | 1979272..1979763 | - | 492 | WP_020978269.1 | staphylokinase | - |
SAKOR_RS09900 | 1979954..1980709 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAKOR_RS09905 | 1980721..1980975 | - | 255 | WP_000611512.1 | phage holin | - |
SAKOR_RS09910 | 1981027..1981134 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 1981056..1981195 | + | 140 | NuclAT_0 | - | - |
- | 1981056..1981195 | + | 140 | NuclAT_0 | - | - |
- | 1981056..1981195 | + | 140 | NuclAT_0 | - | - |
- | 1981056..1981195 | + | 140 | NuclAT_0 | - | - |
- | 1981064..1981119 | + | 56 | - | - | Antitoxin |
SAKOR_RS14440 | 1981187..1981363 | - | 177 | WP_011447039.1 | putative holin-like toxin | Toxin |
SAKOR_RS09920 | 1981513..1981809 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
SAKOR_RS09925 | 1981867..1982154 | - | 288 | WP_001040261.1 | hypothetical protein | - |
SAKOR_RS09930 | 1982201..1982353 | - | 153 | WP_001153681.1 | hypothetical protein | - |
SAKOR_RS09935 | 1982343..1986128 | - | 3786 | WP_000582165.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / scn / chp / sak / hlb / groEL | 1976719..2028927 | 52208 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T29974 WP_011447039.1 NC_022226:c1981363-1981187 [Staphylococcus aureus subsp. aureus CN1]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T29974 NC_022226:c1981363-1981187 [Staphylococcus aureus subsp. aureus CN1]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT29974 NC_022226:1981064-1981119 [Staphylococcus aureus subsp. aureus CN1]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|