Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1816941..1817121 | Replicon | chromosome |
Accession | NC_022226 | ||
Organism | Staphylococcus aureus subsp. aureus CN1 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | SAKOR_RS14895 | Protein ID | WP_001801861.1 |
Coordinates | 1816941..1817036 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1817064..1817121 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAKOR_RS08830 | 1811983..1812609 | + | 627 | WP_000669021.1 | hypothetical protein | - |
SAKOR_RS08835 | 1812650..1812991 | + | 342 | WP_000627547.1 | DUF3969 family protein | - |
SAKOR_RS08840 | 1813092..1813663 | + | 572 | Protein_1694 | hypothetical protein | - |
SAKOR_RS08845 | 1813861..1814418 | - | 558 | WP_000864139.1 | ImmA/IrrE family metallo-endopeptidase | - |
SAKOR_RS08855 | 1814789..1814965 | - | 177 | WP_000375476.1 | hypothetical protein | - |
SAKOR_RS08860 | 1814976..1815359 | - | 384 | WP_000070811.1 | hypothetical protein | - |
SAKOR_RS08865 | 1816044..1816490 | - | 447 | WP_000747802.1 | DUF1433 domain-containing protein | - |
SAKOR_RS14895 | 1816941..1817036 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1817064..1817121 | - | 58 | - | - | Antitoxin |
SAKOR_RS08875 | 1817159..1817260 | + | 102 | WP_001791232.1 | hypothetical protein | - |
SAKOR_RS14385 | 1817238..1817420 | - | 183 | Protein_1701 | transposase | - |
SAKOR_RS08880 | 1817608..1817982 | - | 375 | WP_000695818.1 | DUF1433 domain-containing protein | - |
SAKOR_RS08885 | 1818004..1818351 | - | 348 | WP_001566695.1 | DUF1433 domain-containing protein | - |
SAKOR_RS08890 | 1818588..1819004 | - | 417 | WP_020978241.1 | DUF1433 domain-containing protein | - |
SAKOR_RS08895 | 1819651..1820769 | - | 1119 | WP_000072558.1 | restriction endonuclease subunit S | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | lukD / hlgA / selk | 1787408..1844272 | 56864 | |
- | inside | Prophage | - | lukD / hlgA / selk | 1791126..1846940 | 55814 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T29970 WP_001801861.1 NC_022226:1816941-1817036 [Staphylococcus aureus subsp. aureus CN1]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T29970 NC_022226:1816941-1817036 [Staphylococcus aureus subsp. aureus CN1]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT29970 NC_022226:c1817121-1817064 [Staphylococcus aureus subsp. aureus CN1]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|